Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Products
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
DNMT3B Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DNMT3B |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-OCT3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT3 Antibody: A synthesized peptide derived from human 41185 |
Rabbit Polyclonal Anti-MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Mouse Monoclonal Anti-CD4 Antibody [9H5A8]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD4 Antibody [8G1B12]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V). |
| Modifications | Phospho-specific |
Anti-SOX1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1 |
Anti-FOXA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2 |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal GATA4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA4 |
Rabbit Polyclonal GATA4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA4 |
Rabbit Polyclonal GATA4 (Ser105) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA4 around the phosphorylation site of Serine 105 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
| Modifications | Phospho-specific |
Rabbit polyclonal GATA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GATA4. |
Active filters
Reactivities
- Rat
Families
- Induced pluripotent stem cells
Filter by
Category
Target Symbol
- PDX1 (37)
- MYC (32)
- BMP6 (23)
- KLF5 (22)
- BMP4 (20)
- OTX2 (20)
- SOX9 (20)
- CD4 (19)
- GATA4 (18)
- SOX2 (15)
- FOXA2 (10)
- POU5F1 (9)
- DPPA2 (7)
- BDNF (6)
- KLF4 (6)
- FGF4 (5)
- TCF3 (4)
- AXIN2 (3)
- BMP2 (3)
- DNMT3B (3)
- EGF (3)
- SOX1 (3)
- PDGFC (2)
- SOX11 (2)
- SOX7 (2)
- BMP5 (1)
- BMP7 (1)
- CD38 (1)
- GDF3 (1)
- NANOG (1)
- NODAL (1)
- SOX10 (1)
- SOX4 (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- TGF-beta signaling pathway (81)
- Pathways in cancer (66)
- Hedgehog signaling pathway (48)
- Maturity onset diabetes of the young (47)
- MAPK signaling pathway (46)
- Endometrial cancer (38)
- Type II diabetes mellitus (37)
- Acute myeloid leukemia (35)
- Bladder cancer (35)
- Colorectal cancer (35)
- ErbB signaling pathway (35)
- Wnt signaling pathway (35)
- Cell cycle (32)
- Chronic myeloid leukemia (32)
- Jak-STAT signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Basal cell carcinoma (26)
- Hematopoietic cell lineage (23)
- Antigen processing and presentation (19)
- Cell adhesion molecules (CAMs) (19)
- Primary immunodeficiency (19)
- T cell receptor signaling pathway (19)
- Melanoma (10)
- Regulation of actin cytoskeleton (10)
- Cytokine-cytokine receptor interaction (9)
- Endocytosis (6)
- Huntington's disease (6)
- Neurotrophin signaling pathway (6)
- Focal adhesion (5)
- Gap junction (5)
- Prostate cancer (5)
- Metabolic pathways (4)
- Cysteine and methionine metabolism (3)
- Glioma (3)
- Melanogenesis (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Calcium signaling pathway (1)
- Nicotinate and nicotinamide metabolism (1)