Germany
Japan
United Kingdom
China
NR2C2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group C, member 2 (NR2C2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, NR2C2 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NR2C2 (mGFP-tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NR2C2 (GFP-tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NR2C2 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NR2C2 (mGFP-tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NR2C2 (myc-DDK-tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the C terminal of human NR2C2. Synthetic peptide located within the following region: AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS |
NR2C2 (untagged)-Human nuclear receptor subfamily 2, group C, member 2 (NR2C2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of nuclear receptor subfamily 2, group C, member 2 (NR2C2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal NR2C2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This NR2C2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-466 amino acids from the C-terminal region of human NR2C2. |
NR2C2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Anti-Testicular Receptor 4 (TR4) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the N-terminal region of mouse TR4 |
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK |
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: FTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVIL |
Carrier-free (BSA/glycerol-free) NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2C2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2C2 mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2C2 mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2C2 mouse monoclonal antibody, clone OTI7E6 (formerly 7E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NR2C2 MS Standard C13 and N15-labeled recombinant protein (NP_003289)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NR2C2 (GFP-tagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR2C2 (untagged) - Human nuclear receptor subfamily 2, group C, member 2 (NR2C2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NR2C2
Families
- Nuclear Hormone Receptor