Germany
Japan
United Kingdom
China
CYP7B1 (Myc-DDK-tagged)-Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Lenti ORF particles, CYP7B1 (Myc-DDK tagged) - Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP7B1 (mGFP-tagged) - Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP7B1 (Myc-DDK tagged) - Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP7B1 (mGFP-tagged) - Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP7B1 (GFP-tagged) - Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CYP7B1 (untagged)-Human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Cytochrome P450 7B1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human |
| Immunogen | Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1. |
CYP7B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CYP7B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
CYP7B1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
Transient overexpression lysate of cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP7B1 MS Standard C13 and N15-labeled recombinant protein (NP_004811)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of CYP7B1 (NM_004820) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP7B1 (NM_004820) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP7B1 (NM_004820) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP7B1
Families
- P450