Products

cDNA Clones (29)
Proteins (16)
Antibodies (10)
Jump to Filters
View as table Download
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone
RC222302

USD 420.00

In Stock

CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CKII alpha (CSNK2A1) (NM_177559) Human Untagged Clone
SC107027

USD 310.00

In Stock

CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone
RG208789

USD 460.00

In Stock

CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone
RC222256

USD 420.00

In Stock

CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone
RC208789

USD 420.00

2 Weeks

CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone
RG222302

USD 460.00

In Stock

CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone
RC208789L3

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone Lentiviral Particle
RC208789L3V

USD 820.00

11 Weeks

Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone
RC208789L4

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone Lentiviral Particle
RC208789L4V

USD 820.00

11 Weeks

Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone
RC222256L3

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone Lentiviral Particle
RC222256L3V

USD 820.00

6 Weeks

Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone
RC222256L4

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone Lentiviral Particle
RC222256L4V

USD 820.00

6 Weeks

Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone
RC222302L3

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone Lentiviral Particle
RC222302L3V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone
RC222302L4

USD 620.00

In Stock

Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone Lentiviral Particle
RC222302L4V

USD 820.00

3 Weeks

Lenti ORF particles, CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CKII alpha (CSNK2A1) (NM_177559) Human Tagged ORF Clone
RG222256

USD 460.00

3 Weeks

CSNK2A1 (GFP-tagged) - Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CKII alpha (CSNK2A1) (NM_001895) Human Untagged Clone
SC109127

USD 310.00

In Stock

CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CKII alpha (CSNK2A1) (NM_001895) Human Untagged Clone
SC323395

USD 760.00

In Stock

CSNK2A1 (untagged)-Kinase deficient mutant (K68M) of Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CKII alpha (CSNK2A1) (NM_177559) Human Untagged Clone
SC323516

USD 760.00

In Stock

CSNK2A1 (untagged)-Kinase deficient mutant (K68M) of Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CKII alpha (CSNK2A1) (NM_177560) Human Recombinant Protein
TP760181

USD 215.00

In Stock

Recombinant protein of human casein kinase 2, alpha 1 polypeptide (CSNK2A1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
CKII alpha (CSNK2A1) (NM_177560) Human Tagged ORF Clone
RC208789L1

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (Myc-DDK-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CKII alpha (CSNK2A1) (NM_001895) Human Tagged ORF Clone
RC222302L2

USD 620.00

3 Weeks

Lenti-ORF clone of CSNK2A1 (mGFP-tagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
AP20375PU-N

USD 370.00

2 Weeks

CKII alpha (CSNK2A1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Casein kinase II subunit alpha (1-391, His-tag) Human Protein
AR50280PU-S

USD 415.00

2 Weeks

Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
CKII alpha (CSNK2A1) (NM_001895) Human Over-expression Lysate
LC419673

USD 121.00

In Stock

CSNK2A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CKII alpha (CSNK2A1) (NM_001895) Human Over-expression Lysate
LY419673

USD 396.00

In Stock

Transient overexpression lysate of casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
TA325032

USD 450.00

5 Days

Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1).
CKII alpha (CSNK2A1) pThr360/pSer362 Rabbit Polyclonal Antibody
AP26043PU-N

USD 300.00

2 Weeks

CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around phosphorylation site of Threonine 360/Serine 362
CKII alpha (CSNK2A1) pThr360/pSer362 Rabbit Polyclonal Antibody
AP26043PU-S

USD 230.00

2 Weeks

CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around phosphorylation site of Threonine 360/Serine 362
CKII alpha (CSNK2A1) (353-357) Rabbit Polyclonal Antibody
AP26072PU-N

USD 300.00

2 Weeks

CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa. 353~357
CKII alpha (CSNK2A1) (353-357) Rabbit Polyclonal Antibody
AP26072PU-S

USD 230.00

2 Weeks

CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa. 353~357
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
TA333187

USD 345.00

3 Weeks

Phospho-CSNK2A1-T360/S362 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T360/S362 of human CSNK2A1
Modifications Phospho-specific
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
TA340033

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK2A1 antibody: synthetic peptide directed towards the middle region of human CSNK2A1. Synthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
Casein kinase II subunit alpha (1-391, His-tag) Human Protein
AR50008PU-N

USD 845.00

2 Weeks

Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Casein kinase II subunit alpha (1-391, His-tag) Human Protein
AR50008PU-S

USD 330.00

2 Weeks

Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Casein kinase II subunit alpha (1-391, His-tag) Human Protein
AR50280PU-N

USD 1,105.00

2 Weeks

Casein kinase II subunit alpha (1-391, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CKII alpha (CSNK2A1) (NM_001895) Human Mass Spec Standard
PH322302

USD 2,055.00

3 Weeks

CSNK2A1 MS Standard C13 and N15-labeled recombinant protein (NP_001886)

Tag C-Myc/DDK
Expression Host HEK293
CKII alpha (CSNK2A1) (NM_177560) Human Untagged Clone
SC108394

USD 420.00

3 Weeks

CSNK2A1 (untagged)-Human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 3

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SC108394 is the updated version of SC108395.
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
TA323094

USD 345.00

In Stock

Anti-CSNK2A1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide
CKII alpha (CSNK2A1) Rabbit Polyclonal Antibody
TA323095

USD 345.00

In Stock

Anti-CSNK2A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide
CKII alpha (CSNK2A1) ICC Control Block
TB408789

USD 1,070.00

4 Weeks

Transient overexpression of CSNK2A1 (NM_177560) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CKII alpha (CSNK2A1) ICC Control Block
TB422256

USD 1,070.00

4 Weeks

Transient overexpression of CSNK2A1 (NM_177559) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CKII alpha (CSNK2A1) ICC Control Block
TB422302

USD 1,070.00

4 Weeks

Transient overexpression of CSNK2A1 (NM_001895) in HEK293T cells paraffin embedded controls for ICC/IHC staining