TGFB1 (untagged)-Human transforming growth factor, beta 1 (TGFB1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TGFB1 (untagged)-Human transforming growth factor, beta 1 (TGFB1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TGFB1 (Myc-DDK-tagged)-Human transforming growth factor, beta 1 (TGFB1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human transforming growth factor, beta 1 (TGFB1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TGFB1 (GFP-tagged) - Human transforming growth factor, beta 1 (TGFB1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (Myc-DDK tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (mGFP-tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (Myc-DDK tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (mGFP-tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
Tag | tag free |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1).
Tag | Tag Free |
Expression Host | HEK293 |
Lenti ORF clone of Human transforming growth factor, beta 1 (TGFB1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified
Applications | Assay, ELISA, FC, IHC, NEUT, WB |
Reactivities | Human |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
Applications | ELISA, FN, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Lenti ORF clone of Human transforming growth factor, beta 1 (TGFB1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1).
Tag | Tag Free |
Expression Host | CHO |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
Tag | Tag Free |
Expression Host | CHO |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1. |
Rabbit Polyclonal Anti-TGF beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit anti-TGFB1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Rabbit Polyclonal Anti-Tgfb1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV |
Rabbit polyclonal TGF beta 1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length). |
Rabbit anti TGF beta Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |
Rabbit anti TGF beta 1 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A Recombinant protein encoding human TGF beta 1 aa 177-391 expressed in E.Coli. |
TGFB1 (279-390) human recombinant protein, 0.5 mg
Expression Host | E. coli |
TGFB1 (279-390) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) TGFB1 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TGFB1 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFB1 MS Standard C13 and N15-labeled recombinant protein (NP_000651)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-TGFB1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 30-278 amino acids of human transforming growth factor, beta 1 |
TGFB1 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TGFB1 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
TGFB1 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TGFB1 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
Tag | tag free |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
Tag | tag free |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
Tag | tag free |
Expression Host | HEK293 |
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack