Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
EFEMP1 (Myc-DDK-tagged)-Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
EFEMP1 (GFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EFEMP1 (Myc-DDK-tagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EFEMP1 (Myc-DDK-tagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EFEMP1 (GFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EFEMP1 (GFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EFEMP1 (untagged)-Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-EFEMP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV |
EFEMP1 (C-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
EFEMP1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 126-156aa) of human Fibulin-3 |
Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Fibulin 3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fibulin 3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human Fibulin 3. |
Rabbit polyclonal anti-EFEMP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFEMP1. |
Rabbit Polyclonal Anti-EFEMP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS |
Rabbit Polyclonal Anti-EFEMP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV |
EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
EFEMP1 (untagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EFEMP1 (untagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EFEMP1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Carrier-free (BSA/glycerol-free) EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
EFEMP1 mouse monoclonal antibody,clone 1D9, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
EFEMP1 mouse monoclonal antibody,clone 1D9, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of EFEMP1 (NM_001039349) in HEK293T cells paraffin embedded controls for ICC/IHC staining