Germany
Japan
United Kingdom
China
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table DownloadEFEMP1 (Myc-DDK-tagged)-Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
EFEMP1 (GFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
EFEMP1 (Myc-DDK-tagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EFEMP1 (Myc-DDK-tagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EFEMP1 (Myc-DDK tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EFEMP1 (mGFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
EFEMP1 (GFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EFEMP1 (GFP-tagged) - Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EFEMP1 (untagged)-Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV |
Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-EFEMP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFEMP1. |
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS |
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV |
EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
EFEMP1 (untagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
EFEMP1 (untagged)-Human EGF containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
EFEMP1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
5 Days
Transient overexpression of EFEMP1 (NM_001039349) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- EFEMP1
Families
- Secreted Protein