Germany
Japan
United Kingdom
China
GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GEMIN2 (Myc-DDK tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, GEMIN2 (mGFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GEMIN2 (GFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, GEMIN2 (Myc-DDK tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, GEMIN2 (mGFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GEMIN2 (mGFP-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, GEMIN2 (mGFP-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GEMIN2 (Myc-DDK tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GEMIN2 (mGFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GEMIN2 (GFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GEMIN2 (GFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-SIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GEMIN2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GEMIN2 (untagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GEMIN2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GEMIN2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422905 is the same product as LY425269.
Transient overexpression lysate of survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SIP1 MS Standard C13 and N15-labeled recombinant protein (NP_003607)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GEMIN2 (untagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant beta
| Vector | pCMV6 series |
| Tag | Tag Free |
GEMIN2 (untagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- GEMIN2
Families
- Stem cell - Pluripotency