Germany
Japan
United Kingdom
China
STIP1 (Myc-DDK-tagged)-Human stress-induced-phosphoprotein 1 (STIP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human stress-induced-phosphoprotein 1 (STIP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, STIP1 (Myc-DDK tagged) - Human stress-induced-phosphoprotein 1 (STIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, STIP1 (mGFP-tagged) - Human stress-induced-phosphoprotein 1 (STIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human stress-induced-phosphoprotein 1 (STIP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STIP1 (Myc-DDK tagged) - Human stress-induced-phosphoprotein 1 (STIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, STIP1 (mGFP-tagged) - Human stress-induced-phosphoprotein 1 (STIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STIP1 (myc-DDK-tagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STIP1 (myc-DDK-tagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STIP1 (GFP-tagged) - Human stress-induced-phosphoprotein 1 (STIP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human stress-induced-phosphoprotein 1 (STIP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human stress-induced-phosphoprotein 1 (STIP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
STIP1 (untagged)-Human stress-induced-phosphoprotein 1 (STIP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of stress-induced-phosphoprotein 1 (STIP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human stress-induced-phosphoprotein 1 (STIP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
STIP1 (untagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with N-terminal His tag, expressed in sf9 cells
| Tag | N-His |
| Expression Host | Sf9 |
STIP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS |
Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with C-terminal DDK tag, expressed in sf9 cells
| Tag | C-DDK |
| Expression Host | Sf9 |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the N terminal of human STIP1. Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM |
STIP1 (1-543, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
STIP1 (1-543, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
STIP1 MS Standard C13 and N15-labeled recombinant protein (NP_006810)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
STIP1 (GFP-tagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STIP1 (GFP-tagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STIP1 (untagged) - Human stress-induced phosphoprotein 1 (STIP1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of STIP1 (NM_006819) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of STIP1 (NM_001282653) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of STIP1 (NM_001282652) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of STIP1 (NM_006819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of STIP1 (NM_006819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of STIP1 (NM_001282653) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of STIP1 (NM_001282652) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- STIP1
Families
- Stem cell - Pluripotency