Products

Primary Antibodies (244)
View as table Download

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-IRF3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IRF3

Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L).
Modifications Phospho-specific

Rabbit anti-NFKBIB Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFKBIB

Mouse Monoclonal RelA/NFkB p65 Antibody (112A1021)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-IKBKG Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IKBKG

Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932
Modifications Phospho-specific

Rabbit Polyclonal IRF7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7.

Rabbit Polyclonal NFkB1/NFkB p105 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838]

Rabbit polyclonal IRF-3 (Ser386) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 386 (A-S-SP-L-E).
Modifications Phospho-specific

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE

Rabbit Polyclonal Anti-NFKB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NFKB1

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NFKBIB

Rabbit polyclonal NFkB p65 phospho S536 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein.

Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536
Modifications Phospho-specific

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

Rabbit Polyclonal NF-kappaB p65 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65

Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R).
Modifications Phospho-specific

Rabbit polyclonal IKK-gamma (Ab-85) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R)

Rabbit polyclonal anti-OR10G6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10G6.

Rabbit polyclonal NF-kB p65 (Ab-311) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of serine 311 (F-K-SP-I-M).

Rabbit polyclonal NF-kB p105/p50 (Ser893) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NF-?B p105/p50 around the phosphorylation site of serine 893.
Modifications Phospho-specific

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-POLR3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR

Rabbit Polyclonal Anti-POLR3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Rabbit Polyclonal Anti-POLR1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Rabbit Polyclonal Anti-POLR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED

Rabbit Polyclonal Anti-NF-kB p65 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NF-?B p65 Antibody: A synthesized peptide derived from human NF-?B p65

NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 400-450 of Human NFkB-p65.

NFKB1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 900-950 of Human NFkB-p105.

NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat

IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Rabbit Polyclonal IRF3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IRF3 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human IRF3.

Rabbit Polyclonal POLR3F Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F.

Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802)

Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920)

Rabbit polyclonal anti-IKK-gamma antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IKK-?.

Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P).
Modifications Phospho-specific

Rabbit polyclonal NF-kB p65(Ab-276) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of Serine 276.

Rabbit polyclonal NF-kB p65 (Ser281) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NF-kB p65 around the phosphorylation site of serine 281 (E-L-SP-E-P)
Modifications Phospho-specific

Rabbit polyclonal anti-RPC4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC4.

Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Ser23, Mouse: Ser23, Rat: Ser23
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23.
Modifications Phospho-specific

Rabbit polyclonal anti-POLR3H (RPC8) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC8.

Rabbit Polyclonal IKK-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-beta

Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188
Modifications Phospho-specific