Products

cDNA Clones (30)
Proteins (20)
Antibodies (6)
Jump to Filters
View as table Download
VARS2 (NM_020442) Human Tagged ORF Clone
RC211310

USD 1,120.00

In Stock

VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACAD8 (NM_014384) Human Tagged ORF Clone
RC201507

USD 420.00

In Stock

ACAD8 (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACAD8 (NM_014384) Human Recombinant Protein
TP301507

USD 823.00

In Stock

Recombinant protein of human acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8)

Tag C-Myc/DDK
Expression Host HEK293T
VARS2 (NM_020442) Human Recombinant Protein
TP311310

USD 823.00

4 Weeks

Recombinant protein of human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
ACAD8 (NM_014384) Human Tagged ORF Clone
RG201507

USD 460.00

In Stock

ACAD8 (GFP-tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VARS2 (NM_020442) Human Tagged ORF Clone
RG211310

USD 1,230.00

In Stock

VARS2 (GFP-tagged) - Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VARS2 (NM_001167733) Human Tagged ORF Clone
RC230585

USD 420.00

5 Weeks

VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACAD8 (NM_014384) Human Tagged ORF Clone
RC201507L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAD8 (NM_014384) Human Tagged ORF Clone Lentiviral Particle
RC201507L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACAD8 (Myc-DDK tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAD8 (NM_014384) Human Tagged ORF Clone
RC201507L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACAD8 (NM_014384) Human Tagged ORF Clone Lentiviral Particle
RC201507L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACAD8 (mGFP-tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_020442) Human Tagged ORF Clone
RC211310L3

USD 1,320.00

3 Weeks

Lenti ORF clone of Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_020442) Human Tagged ORF Clone Lentiviral Particle
RC211310L3V

USD 1,520.00

6 Weeks

Lenti ORF particles, VARS2 (Myc-DDK tagged) - Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_020442) Human Tagged ORF Clone
RC211310L4

USD 1,320.00

3 Weeks

Lenti ORF clone of Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_020442) Human Tagged ORF Clone Lentiviral Particle
RC211310L4V

USD 1,520.00

6 Weeks

Lenti ORF particles, VARS2 (mGFP-tagged) - Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167733) Human Tagged ORF Clone
RC230585L3

USD 620.00

5 Weeks

Lenti-ORF clone of VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167733) Human Tagged ORF Clone Lentiviral Particle
RC230585L3V

USD 820.00

8 Weeks

Lenti ORF particles, VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167733) Human Tagged ORF Clone
RC230585L4

USD 620.00

5 Weeks

Lenti-ORF clone of VARS2 (mGFP-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167733) Human Tagged ORF Clone Lentiviral Particle
RC230585L4V

USD 820.00

8 Weeks

Lenti ORF particles, VARS2 (mGFP-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167734) Human Tagged ORF Clone
RC230647

USD 1,150.00

5 Weeks

VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VARS2 (NM_001167734) Human Tagged ORF Clone
RC230647L3

USD 1,350.00

5 Weeks

Lenti-ORF clone of VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167734) Human Tagged ORF Clone Lentiviral Particle
RC230647L3V

USD 1,550.00

8 Weeks

Lenti ORF particles, VARS2 (Myc-DDK-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167734) Human Tagged ORF Clone
RC230647L4

USD 1,350.00

5 Weeks

Lenti-ORF clone of VARS2 (mGFP-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167734) Human Tagged ORF Clone Lentiviral Particle
RC230647L4V

USD 1,550.00

8 Weeks

Lenti ORF particles, VARS2 (mGFP-tagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VARS2 (NM_001167733) Human Tagged ORF Clone
RG230585

USD 460.00

5 Weeks

VARS2 (GFP-tagged) - Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VARS2 (NM_001167734) Human Tagged ORF Clone
RG230647

USD 1,260.00

6 Weeks

VARS2 (GFP-tagged) - Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACAD8 (NM_014384) Human Over-expression Lysate
LC415328

USD 121.00

In Stock

ACAD8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACAD8 (NM_014384) Human Over-expression Lysate
LY415328

USD 396.00

5 Days

Transient overexpression lysate of acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

VARS2 (NM_020442) Human Over-expression Lysate
LY412450

USD 396.00

5 Days

Transient overexpression lysate of valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

VARS2 (NM_020442) Human Untagged Clone
SC100467

USD 1,100.00

In Stock

VARS2 (untagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACAD8 (NM_014384) Human Untagged Clone
SC115026

USD 310.00

In Stock

ACAD8 (untagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACAD8 (NM_014384) Human Untagged Clone
SC322237

USD 760.00

In Stock

ACAD8 (untagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ACAD8 Rabbit Polyclonal Antibody
TA308261

USD 415.00

5 Days

Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7)
ACAD8 Rabbit Polyclonal Antibody
TA334527

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACAD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAD8 antibody is: synthetic peptide directed towards the N-terminal region of Human ACAD8. Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV
ACAD8 (Center) Rabbit Polyclonal Antibody
AP50037PU-N

USD 450.00

2 Weeks

ACAD8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 125~154 amino acids from the Central region of human ACAD8
VARS2 Rabbit Polyclonal Antibody
TA342462

USD 375.00

5 Days

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
ACAD8 (23-415, His-tag) Human Protein
AR51241PU-N

USD 845.00

2 Weeks

ACAD8 (23-415, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ACAD8 (23-415, His-tag) Human Protein
AR51241PU-S

USD 330.00

2 Weeks

ACAD8 (23-415, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
VARS2 (NM_020442) Human Over-expression Lysate
LC412450

USD 121.00

2 Weeks

VARS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACAD8 (NM_014384) Human Mass Spec Standard
PH301507

USD 2,055.00

3 Weeks

ACAD8 MS Standard C13 and N15-labeled recombinant protein (NP_055199)

Tag C-Myc/DDK
Expression Host HEK293
VARS2 (NM_020442) Human Mass Spec Standard
PH311310

USD 2,055.00

3 Weeks

VARS2 MS Standard C13 and N15-labeled recombinant protein (NP_065175)

Tag C-Myc/DDK
Expression Host HEK293
VARS2 (NM_020442) Human Untagged Clone
SC318474

USD 1,100.00

3 Weeks

VARS2 (untagged)-Human valyl-tRNA synthetase 2, mitochondrial (putative) (VARS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
VARS2 (NM_001167733) Human Untagged Clone
SC329223

USD 760.00

5 Weeks

VARS2 (untagged)-Human valyl-tRNA synthetase 2 mitochondrial (putative) (VARS2) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VARS2 (NM_001167734) Human Untagged Clone
SC329285

USD 2,210.00

6 Weeks

VARS2 (untagged)-Human valyl-tRNA synthetase 2 mitochondrial (putative) (VARS2) transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACAD8 Rabbit Polyclonal Antibody
TA322378

USD 345.00

In Stock

Anti-ACAD8 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase family, member 8
ACAD8 Rabbit Polyclonal Antibody
TA322379

USD 345.00

In Stock

Anti-ACAD8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase family, member 8
ACAD8 (NM_014384) ICC Control Block
TB401507

USD 1,070.00

4 Weeks

Transient overexpression of ACAD8 (NM_014384) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VARS2 (NM_020442) ICC Control Block
TB411310

USD 1,770.00

4 Weeks

Transient overexpression of VARS2 (NM_020442) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VARS2 (NM_001167733) ICC Control Block
TB430585

USD 1,070.00

4 Weeks

Transient overexpression of VARS2 (NM_001167733) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VARS2 (NM_001167734) ICC Control Block
TB430647

USD 1,800.00

4 Weeks

Transient overexpression of VARS2 (NM_001167734) in HEK293T cells paraffin embedded controls for ICC/IHC staining