Products

View as table Download

ARNTL (Myc-DDK-tagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ARNTL (Myc-DDK-tagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ARNTL (Myc-DDK-tagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ARNTL (GFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ARNTL (Myc-DDK tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ARNTL (mGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, ARNTL (Myc-DDK tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ARNTL (mGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, ARNTL (mGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ARNTL (GFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ARNTL (GFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARNTL (Myc-DDK tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARNTL (mGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARNTL (Myc-DDK tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARNTL (mGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARNTL (Myc-DDK tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

ARNTL (myc-DDK-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ARNTL (myc-DDK-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ARNTL (myc-DDK-tagged) - Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ARNTL (untagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

ARNTL (untagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

ARNTL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ARNTL (untagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

ARNTL (untagged)-Human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Antibody against MOP3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human MOP3 (C-terminus).

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

ARNTL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Antibody against BMAL

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human BMAL1

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

Goat Anti-BMAL1 / ARNTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1.

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

ARNTL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444)

Tag C-Myc/DDK
Expression Host HEK293

ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169)

Tag C-Myc/DDK
Expression Host HEK293

ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443)

Tag C-Myc/DDK
Expression Host HEK293