Products

Proteins (27)
cDNA Clones (27)
Antibodies (21)
Jump to Filters
View as table Download
EDF1 (NM_003792) Human Tagged ORF Clone
RC201996

USD 98.00

USD 390.00

In Stock

EDF1 (Myc-DDK-tagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EDF1 (NM_153200) Human Tagged ORF Clone
RC212036

USD 98.00

USD 390.00

In Stock

EDF1 (Myc-DDK-tagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EDF1 (NM_003792) Human Tagged ORF Clone Lentiviral Particle
RC201996L1V

USD 820.00

3 Weeks

Lenti ORF particles, EDF1 (Myc-DDK tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EDF1 (NM_003792) Human Tagged ORF Clone Lentiviral Particle
RC201996L2V

USD 820.00

6 Weeks

Lenti ORF particles, EDF1 (mGFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EDF1 (NM_003792) Human Recombinant Protein
TP301996

USD 823.00

In Stock

Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha

Tag C-Myc/DDK
Expression Host HEK293T
EDF1 (NM_003792) Human Tagged ORF Clone
RG201996

USD 460.00

In Stock

EDF1 (GFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_003792) Human Tagged ORF Clone
RC201996L3

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_003792) Human Tagged ORF Clone Lentiviral Particle
RC201996L3V

USD 820.00

5 Weeks

Lenti ORF particles, EDF1 (Myc-DDK tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_003792) Human Tagged ORF Clone
RC201996L4

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_003792) Human Tagged ORF Clone Lentiviral Particle
RC201996L4V

USD 820.00

7 Weeks

Lenti ORF particles, EDF1 (mGFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_153200) Human Tagged ORF Clone
RC212036L3

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_153200) Human Tagged ORF Clone Lentiviral Particle
RC212036L3V

USD 820.00

6 Weeks

Lenti ORF particles, EDF1 (Myc-DDK tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_153200) Human Tagged ORF Clone
RC212036L4

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_153200) Human Tagged ORF Clone Lentiviral Particle
RC212036L4V

USD 820.00

6 Weeks

Lenti ORF particles, EDF1 (mGFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EDF1 (NM_001281298) Human Tagged ORF Clone
RC235847

USD 420.00

2 Weeks

EDF1 (myc-DDK-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_001281299) Human Tagged ORF Clone
RC235885

USD 420.00

2 Weeks

EDF1 (myc-DDK-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_001281297) Human Tagged ORF Clone
RC235990

USD 420.00

2 Weeks

EDF1 (myc-DDK-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_153200) Human Tagged ORF Clone
RG212036

USD 460.00

3 Weeks

EDF1 (GFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_003792) Human Tagged ORF Clone
RC201996L1

USD 768.00

In Stock

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EDF1 (NM_003792) Human Tagged ORF Clone
RC201996L2

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EDF1 Rabbit Polyclonal Antibody
TA343423

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the middle region of human EDF1. Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
EDF1 (NM_003792) Human Over-expression Lysate
LC418427

USD 121.00

In Stock

EDF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EDF1 (NM_003792) Human Untagged Clone
SC117765

USD 310.00

In Stock

EDF1 (untagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
EDF1 Goat Polyclonal Antibody
TA321034

USD 375.00

5 Days

Goat Polyclonal Anti-EDF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_003783.1; NP_694880.1 (NKQHSITKNTAKLDR)
EDF1 Rabbit Polyclonal Antibody
TA339083

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
EDF1 (2-14) Goat Polyclonal Antibody
AP23969PU-N

USD 440.00

2 Weeks

EDF1 (2-14) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Chicken, Human, Monkey, Mouse, Porcine, Rat, Xenopus
Immunogen Synthetic peptide from positions 2-14 of human EDF1 (NP_003783.1)
EDF1 Rabbit Polyclonal Antibody
TA331478

USD 310.00

5 Days

Rabbit polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
EDF1 Rabbit Polyclonal Antibody
TA343422

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EDF1 antibody is: synthetic peptide directed towards the N-terminal region of Human EDF1. Synthetic peptide located within the following region: VTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNT
EDF-1 (1-148, His-tag) Human Protein
AR09593PU-L

USD 845.00

2 Weeks

EDF-1 (1-148, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
EDF-1 (1-148, His-tag) Human Protein
AR09593PU-N

USD 330.00

2 Weeks

EDF-1 (1-148, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
EDF1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
CF810774

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDF1 Mouse Monoclonal Antibody [Clone ID: OTI2G2]
CF810778

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI2G2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDF1 Mouse Monoclonal Antibody [Clone ID: OTI7D9]
CF810789

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI7D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDF1 (NM_153200) Human Over-expression Lysate
LC407133

USD 121.00

2 Weeks

EDF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EDF1 (NM_153200) Human Over-expression Lysate
LC430257

USD 121.00

2 Weeks

EDF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EDF1 (NM_153200) Human Over-expression Lysate
LY407133

USD 396.00

5 Days

Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY407133 is the same product as LY430257.
EDF1 (NM_003792) Human Mass Spec Standard
PH301996

USD 2,055.00

3 Weeks

EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783)

Tag C-Myc/DDK
Expression Host HEK293
EDF1 (NM_153200) Human Mass Spec Standard
PH312036

USD 2,055.00

3 Weeks

EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880)

Tag C-Myc/DDK
Expression Host HEK293
EDF1 (NM_001281298) Human Tagged ORF Clone
RG235847

USD 460.00

2 Weeks

EDF1 (GFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_001281299) Human Tagged ORF Clone
RG235885

USD 460.00

2 Weeks

EDF1 (GFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_001281297) Human Tagged ORF Clone
RG235990

USD 460.00

2 Weeks

EDF1 (GFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EDF1 (NM_153200) Human Untagged Clone
SC306554

USD 420.00

3 Weeks

EDF1 (untagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant beta

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EDF1 (NM_001281298) Human Untagged Clone
SC333741

USD 310.00

2 Weeks

EDF1 (untagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EDF1 (NM_001281299) Human Untagged Clone
SC333779

USD 310.00

2 Weeks

EDF1 (untagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EDF1 (NM_001281297) Human Untagged Clone
SC333884

USD 310.00

2 Weeks

EDF1 (untagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
EDF1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA810774

USD 379.00

In Stock

EDF1 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated