EIF4E2 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E2 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, EIF4E2 (Myc-DDK tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, EIF4E2 (mGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
EIF4E2 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, EIF4E2 (Myc-DDK tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, EIF4E2 (mGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EIF4E2 (myc-DDK-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E2 (myc-DDK-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E2 (myc-DDK-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-EIF4E2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY |
Rabbit Polyclonal Antibody against EIF4E2 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2. |
EIF4E2 (untagged)-Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EIF4E2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of eukaryotic translation initiation factor 4E family member 2 (EIF4E2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EIF4E2 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E2 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E2 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E2 (untagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EIF4E2 (untagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EIF4E2 (untagged) - Human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | HRP |
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |