Products

cDNA Clones (17)
Antibodies (10)
Proteins (9)
Jump to Filters
View as table Download
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone
RC202425

USD 610.00

In Stock

ERCC3 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone Lentiviral Particle
RC202425L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone Lentiviral Particle
RC202425L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone
RG202425

USD 670.00

In Stock

ERCC3 (GFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone
RC202425L3

USD 810.00

3 Weeks

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone Lentiviral Particle
RC202425L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone Lentiviral Particle
RC202425L4V

USD 1,010.00

3 Weeks

Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
XPB (ERCC3) (NM_001303416) Human Tagged ORF Clone
RC239397

USD 610.00

3 Weeks

ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
XPB (ERCC3) (NM_001303418) Human Tagged ORF Clone
RC239398

USD 610.00

3 Weeks

ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
XPB (ERCC3) (NM_000122) Human Over-expression Lysate
LY424913

USD 396.00

5 Days

Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

XPB (ERCC3) (NM_000122) Human Tagged ORF Clone
RC202425L1

USD 1,008.00

In Stock

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
XPB (ERCC3) (NM_000122) Human Untagged Clone
SC120091

USD 310.00

In Stock

ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
XPB (ERCC3) (NM_000122) Human Untagged Clone
SC320745

USD 310.00

In Stock

ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
XPB (ERCC3) Mouse Monoclonal Antibody [Clone ID: 3G4]
TA318145

USD 500.00

In Stock

ERCC3 / XPB Mouse Monoclonal (aa242-261) (3G4) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
XPB (ERCC3) Rabbit Polyclonal Antibody
TA327151

USD 275.00

3 Weeks

ERCC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ERCC3
XPB (ERCC3) (NM_000122) Human Tagged ORF Clone
RC202425L2

USD 810.00

3 Weeks

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
XPB (ERCC3) Rabbit Polyclonal Antibody
TA308754

USD 415.00

5 Days

Rabbit polyclonal antibody to XPB (excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing))

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 521 and 742 of XPB (Uniprot ID#P19447)
XPB (ERCC3) (NM_000122) Human Over-expression Lysate
LC424913

USD 121.00

In Stock

ERCC3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
XPB (ERCC3) Rabbit Polyclonal Antibody
TA323737

USD 345.00

4 Weeks

Anti-ERCC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3
XPB (ERCC3) Rabbit Polyclonal Antibody
TA335162

USD 375.00

5 Days

Rabbit Polyclonal Anti-ERCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
XPB (ERCC3) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF809371

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPB (ERCC3) (NM_001303416) Human Tagged ORF Clone
RG239397

USD 650.00

2 Weeks

ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
XPB (ERCC3) (NM_001303418) Human Tagged ORF Clone
RG239398

USD 650.00

2 Weeks

ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
XPB (ERCC3) (NM_001303416) Human Untagged Clone
SC337291

USD 730.00

3 Weeks

ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
XPB (ERCC3) (NM_001303418) Human Untagged Clone
SC337292

USD 730.00

3 Weeks

ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
XPB (ERCC3) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
TA809371

USD 379.00

In Stock

ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPB (ERCC3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H8]
TA809371AM

USD 420.00

4 Weeks

ERCC3 mouse monoclonal antibody,clone OTI6H8, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
XPB (ERCC3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H8]
TA809371BM

USD 420.00

4 Weeks

ERCC3 mouse monoclonal antibody,clone OTI6H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
XPB (ERCC3) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
TA809371S

USD 159.00

In Stock

ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPB (ERCC3) ICC Control Block
TB402425

USD 1,260.00

4 Weeks

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded controls for ICC/IHC staining

XPB (ERCC3) ICC Control Block
TB439397

USD 1,260.00

4 Weeks

Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded controls for ICC/IHC staining

XPB (ERCC3) ICC Control Block
TB439398

USD 1,260.00

4 Weeks

Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded controls for ICC/IHC staining

XPB (ERCC3) Cytosection
TS402425

USD 225.00

4 Weeks

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

XPB (ERCC3) Cytosection
TS402425P5

USD 889.00

4 Weeks

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

XPB (ERCC3) ICC Control Sections
TS439397P5

USD 889.00

4 Weeks

Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

XPB (ERCC3) ICC Control Sections
TS439398P5

USD 889.00

4 Weeks

Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack