Products

View as table Download

ERCC3 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ERCC3 (GFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ERCC3 (Myc-DDK tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ERCC3 (mGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ERCC3 (myc-DDK-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ERCC3 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

ERCC3 / XPB Mouse Monoclonal (aa242-261) (3G4) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

ERCC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ERCC3

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) (ERCC3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal antibody to XPB (excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing))

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 521 and 742 of XPB (Uniprot ID#P19447)

ERCC3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Anti-ERCC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3

Rabbit Polyclonal Anti-ERCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG

Carrier-free (BSA/glycerol-free) ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ERCC3 (GFP-tagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ERCC3 (untagged) - Human excision repair cross-complementation group 3 (ERCC3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERCC3 mouse monoclonal antibody,clone OTI6H8, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ERCC3 mouse monoclonal antibody,clone OTI6H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ERCC3 mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ERCC3 (NM_000122) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ERCC3 (NM_001303416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ERCC3 (NM_001303418) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack