Products

cDNA Clones (21)
Proteins (13)
Antibodies (10)
Jump to Filters
View as table Download
FRA1 (FOSL1) (NM_005438) Human Tagged ORF Clone
RC202104

USD 420.00

In Stock

FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_005438) Human Tagged ORF Clone
RG202104

USD 460.00

In Stock

FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_005438) Human Recombinant Protein
TP302104

USD 823.00

4 Weeks

Recombinant protein of human FOS-like antigen 1 (FOSL1)

Tag C-Myc/DDK
Expression Host HEK293T
FRA1 (FOSL1) (NM_005438) Human Tagged ORF Clone
RC202104L3

USD 620.00

3 Weeks

Lenti-ORF clone of FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FRA1 (FOSL1) (NM_001300855) Human Tagged ORF Clone
RC235938

USD 420.00

2 Weeks

FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300857) Human Tagged ORF Clone
RC236235

USD 420.00

2 Weeks

FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300856) Human Tagged ORF Clone
RC236553

USD 420.00

2 Weeks

FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300844) Human Tagged ORF Clone
RC236791

USD 420.00

2 Weeks

FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_005438) Human Untagged Clone
SC125319

USD 310.00

In Stock

FOSL1 (untagged)-Human FOS-like antigen 1 (FOSL1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA326234

USD 345.00

In Stock

Rabbit polyclonal Fra-1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Fra-1.
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA329252

USD 375.00

5 Days

Rabbit Polyclonal anti-FOSL1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
FRA1 (FOSL1) Goat Polyclonal Antibody
TA302492

USD 375.00

5 Days

Goat Polyclonal Antibody against FRA1 / FOSL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QREIEELQKQKER, from the internal region of the protein sequence according to NP_005429.1.
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA329253

USD 375.00

5 Days

Rabbit Polyclonal anti-FOSL1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: EKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSP
FRA1 (FOSL1) Mouse Monoclonal Antibody [Clone ID: OTI12F9]
CF500624

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FOSL1 mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FRA1 (FOSL1) (NM_005438) Human Mass Spec Standard
PH302104

USD 2,055.00

3 Weeks

FOSL1 MS Standard C13 and N15-labeled recombinant protein (NP_005429)

Tag C-Myc/DDK
Expression Host HEK293
FRA1 (FOSL1) (NM_001300855) Human Tagged ORF Clone
RG235938

USD 460.00

2 Weeks

FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300857) Human Tagged ORF Clone
RG236235

USD 460.00

2 Weeks

FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300856) Human Tagged ORF Clone
RG236553

USD 460.00

2 Weeks

FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300844) Human Tagged ORF Clone
RG236791

USD 460.00

2 Weeks

FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRA1 (FOSL1) (NM_001300855) Human Untagged Clone
SC333832

USD 310.00

2 Weeks

FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FRA1 (FOSL1) (NM_001300857) Human Untagged Clone
SC334129

USD 310.00

2 Weeks

FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FRA1 (FOSL1) (NM_001300856) Human Untagged Clone
SC334447

USD 477.00

2 Weeks

FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FRA1 (FOSL1) (NM_001300844) Human Untagged Clone
SC334685

USD 477.00

2 Weeks

FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA321715

USD 345.00

In Stock

Anti-FOSL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-16 amino acids of Human FOS-like antigen 1
FRA1 (FOSL1) Mouse Monoclonal Antibody [Clone ID: OTI12F9]
TA500624

USD 379.00

In Stock

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FRA1 (FOSL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12F9]
TA500624AM

USD 420.00

4 Weeks

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
FRA1 (FOSL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12F9]
TA500624BM

USD 420.00

4 Weeks

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
FRA1 (FOSL1) Mouse Monoclonal Antibody [Clone ID: OTI12F9]
TA500624S

USD 159.00

In Stock

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FRA1 (FOSL1) (NM_005438) ICC Control Block
TB402104

USD 1,070.00

4 Weeks

Transient overexpression of FOSL1 (NM_005438) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FRA1 (FOSL1) (NM_001300855) ICC Control Block
TB435938

USD 1,070.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300855) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FRA1 (FOSL1) (NM_001300857) ICC Control Block
TB436235

USD 1,070.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300857) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FRA1 (FOSL1) (NM_001300856) ICC Control Block
TB436553

USD 1,070.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300856) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FRA1 (FOSL1) (NM_001300844) ICC Control Block
TB436791

USD 1,070.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300844) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FRA1 (FOSL1) Cytosection
TS402104

USD 225.00

4 Weeks

Transient overexpression of FOSL1 (NM_005438) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FRA1 (FOSL1) Cytosection
TS402104P5

USD 889.00

4 Weeks

Transient overexpression of FOSL1 (NM_005438) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FRA1 (FOSL1) ICC Control Sections
TS435938P5

USD 889.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FRA1 (FOSL1) ICC Control Sections
TS436235P5

USD 889.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300857) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FRA1 (FOSL1) ICC Control Sections
TS436553P5

USD 889.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300856) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FRA1 (FOSL1) ICC Control Sections
TS436791P5

USD 889.00

4 Weeks

Transient overexpression of FOSL1 (NM_001300844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack