Products

Antibodies (32)
cDNA Clones (23)
Proteins (6)
Jump to Filters
View as table Download
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495

USD 420.00

In Stock

MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L1V

USD 820.00

6 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L2V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L1V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L2V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RG216495

USD 460.00

In Stock

MAF (GFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247

USD 420.00

In Stock

MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495L3

USD 620.00

In Stock

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone
RC216495L4

USD 620.00

2 Weeks

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L3

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L3V

USD 820.00

11 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L4

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone Lentiviral Particle
RC209247L4V

USD 820.00

5 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L3V

USD 820.00

3 Weeks

Lenti ORF particles, MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Tagged ORF Clone Lentiviral Particle
RC216495L4V

USD 820.00

11 Weeks

Lenti ORF particles, MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402776

USD 680.00

2 Weeks

MAF Mutant (R288P), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation R288P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402777

USD 680.00

2 Weeks

MAF Mutant (K297R), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation K297R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Mutant ORF Clone
RC402778

USD 680.00

2 Weeks

MAF Mutant (R299S), Myc-DDK-tagged ORF clone of Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1 as transfection-ready DNA

Mutation R299S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RG209247

USD 460.00

3 Weeks

MAF (GFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
c Maf (MAF) (NM_005360) Human Untagged Clone
SC116772

USD 690.00

In Stock

MAF (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L2

USD 620.00

In Stock

Lenti-ORF clone of MAF (mGFP-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
c Maf (MAF) Rabbit Polyclonal Antibody
TA347630

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Maf Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Maf Antibody: A synthesized peptide derived from human Maf
c Maf (MAF) (NM_001031804) Human Tagged ORF Clone
RC209247L1

USD 620.00

3 Weeks

Lenti-ORF clone of MAF (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
c Maf (MAF) Rabbit Polyclonal Antibody
TA337003

USD 424.00

2 Weeks

Rabbit Polyclonal c-Maf Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 75-110 of human c-maf was used as the immunogen, GenBank no. NP_001026974.1|.
c Maf (MAF) Rabbit Polyclonal Antibody
TA314171

USD 345.00

4 Weeks

Rabbit polyclonal anti-Maf antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Maf.
c Maf (MAF) Rabbit Polyclonal Antibody
TA343531

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAF antibody is: synthetic peptide directed towards the C-terminal region of Human MAF. Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK
c Maf (MAF) Rabbit Polyclonal Antibody
AP20377PU-N

USD 370.00

2 Weeks

c Maf (MAF) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
c Maf (MAF) Rabbit Polyclonal Antibody
TA330032

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAF antibody: synthetic peptide directed towards the middle region of human MAF. Synthetic peptide located within the following region: LQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI
c Maf (MAF) Rabbit Polyclonal Antibody
TA343530

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAF antibody: synthetic peptide directed towards the N terminal of human MAF. Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2B12]
CF812376

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI2B12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF812377

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI2G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
CF812378

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI8F4]
CF812381

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI8F4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI4H10]
CF812382

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI4H10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) (NM_001031804) Human Untagged Clone
SC302598

USD 760.00

5 Weeks

MAF (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2

Vector pCMV6 series
Tag Tag Free
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2B12]
TA812376

USD 379.00

In Stock

MAF mouse monoclonal antibody,clone OTI2B12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2B12]
TA812376S

USD 159.00

2 Days

MAF mouse monoclonal antibody,clone OTI2B12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
TA812377

USD 379.00

In Stock

MAF mouse monoclonal antibody,clone OTI2G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
TA812377S

USD 159.00

2 Days

MAF mouse monoclonal antibody,clone OTI2G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
TA812378

USD 379.00

In Stock

MAF mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
TA812378S

USD 159.00

2 Days

MAF mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
c Maf (MAF) Mouse Monoclonal Antibody [Clone ID: OTI8F4]
TA812381

USD 379.00

In Stock

MAF mouse monoclonal antibody,clone OTI8F4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated