Products

cDNA Clones (26)
Proteins (19)
Antibodies (2)
Jump to Filters
View as table Download
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532

USD 420.00

In Stock

SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875

USD 420.00

In Stock

SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001290060) Human Tagged ORF Clone
RC239473

USD 420.00

In Stock

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RG223532

USD 460.00

In Stock

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875L3

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone Lentiviral Particle
RC202875L3V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875L4

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone Lentiviral Particle
RC202875L4V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532L3

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone Lentiviral Particle
RC223532L3V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532L4

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone Lentiviral Particle
RC223532L4V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001290062) Human Tagged ORF Clone
RC238019

USD 430.00

2 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290063) Human Tagged ORF Clone
RC238020

USD 430.00

2 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290061) Human Tagged ORF Clone
RC239487

USD 610.00

3 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RG202875

USD 460.00

3 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Untagged Clone
SC117239

USD 310.00

In Stock

SEMA3B (untagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Semaphorin 3B (SEMA3B) (NM_004636) Human Over-expression Lysate
LY417853

USD 396.00

5 Days

Transient overexpression lysate of sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Semaphorin 3B (SEMA3B) (NM_004636) Human Over-expression Lysate
LC417853

USD 121.00

In Stock

SEMA3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Semaphorin 3B (SEMA3B) (NM_001005914) Human Untagged Clone
SC319265

USD 760.00

In Stock

SEMA3B (untagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate
LY423670

USD 396.00

5 Days

Transient overexpression lysate of sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA309848

USD 457.00

5 Days

Rabbit Polyclonal SEMA3B Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).
Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA330905

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEMA3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate
LC423670

USD 121.00

2 Weeks

SEMA3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Semaphorin 3B (SEMA3B) (NM_001290062) Human Tagged ORF Clone
RG238019

USD 470.00

2 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290063) Human Tagged ORF Clone
RG238020

USD 470.00

2 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290060) Human Tagged ORF Clone
RG239473

USD 460.00

2 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290061) Human Tagged ORF Clone
RG239487

USD 650.00

2 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290062) Human Untagged Clone
SC335913

USD 410.00

2 Weeks

SEMA3B (untagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001290063) Human Untagged Clone
SC335914

USD 410.00

2 Weeks

SEMA3B (untagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001290060) Human Untagged Clone
SC337367

USD 760.00

3 Weeks

SEMA3B (untagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Semaphorin 3B (SEMA3B) (NM_001290061) Human Untagged Clone
SC337381

USD 760.00

3 Weeks

SEMA3B (untagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) ICC Control Block
TB402875

USD 1,070.00

4 Weeks

Transient overexpression of SEMA3B (NM_001005914) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) (NM_004636) ICC Control Block
TB423532

USD 1,070.00

4 Weeks

Transient overexpression of SEMA3B (NM_004636) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) (NM_001290062) ICC Control Block
TB438019

USD 1,080.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290062) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) (NM_001290063) ICC Control Block
TB438020

USD 1,080.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290063) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) (NM_001290060) ICC Control Block
TB439473

USD 1,070.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290060) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) (NM_001290061) ICC Control Block
TB439487

USD 1,260.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290061) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 3B (SEMA3B) Cytosection
TS402875

USD 225.00

4 Weeks

Transient overexpression of SEMA3B (NM_001005914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 3B (SEMA3B) Cytosection
TS402875P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_001005914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 3B (SEMA3B) Cytosection
TS423532

USD 225.00

4 Weeks

Transient overexpression of SEMA3B (NM_004636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 3B (SEMA3B) Cytosection
TS423532P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_004636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 3B (SEMA3B) ICC Control Sections
TS438019P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290062) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 3B (SEMA3B) ICC Control Sections
TS438020P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 3B (SEMA3B) Cytosection
TS439473

USD 225.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 3B (SEMA3B) Cytosection
TS439473P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290060) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 3B (SEMA3B) ICC Control Sections
TS439487P5

USD 889.00

4 Weeks

Transient overexpression of SEMA3B (NM_001290061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack