Germany
Japan
United Kingdom
China
DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant a
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadDCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant d
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dclre1c (Myc-DDK-tagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dclre1c (Myc-DDK-tagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dclre1c (Myc-DDK-tagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dclre1c (mGFP-tagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dclre1c (GFP-tagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant b
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) (DCLRE1C), transcript variant a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat polyclonal anti-Artemis antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C). |
DCLRE1C - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
DCLRE1C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DCLRE1C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) (DCLRE1C), transcript variant b
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-DCLRE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL |
qSTAR qPCR primer pairs against Homo sapiens gene DCLRE1C
Rabbit Polyclonal Artemis Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to residues 677-692 [GESIAVKKRKCSLLDT] of the human Artemis protein. |
Rabbit Polyclonal Anti-DCLRE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER |
DCLRE1C CRISPRa kit - CRISPR gene activation of human DNA cross-link repair 1C
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dclre1c CRISPRa kit - CRISPR gene activation of mouse DNA cross-link repair 1C
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DCLRE1C
| Application | Plasmid of exact quantity for transcript copy number calculation |
Dclre1c (untagged) - Mouse DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), transcript variant 3, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dclre1c (untagged) - Mouse DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dclre1c (untagged) - Mouse DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dclre1c (untagged) - Mouse DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dclre1c (untagged) - Mouse DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dclre1c
DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant f
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant h
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant e
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant g
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dclre1c (untagged ORF) - Rat DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) (Dclre1c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of DNA cross-link repair 1C (PSO2 homolog S. cerevisiae) (DCLRE1C) transcript variant b for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of DNA cross-link repair 1C (PSO2 homolog S. cerevisiae) (DCLRE1C) transcript variant c for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of DNA cross-link repair 1C (PSO2 homolog S. cerevisiae) (DCLRE1C) transcript variant d for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of DNA cross-link repair 1C (PSO2 homolog S. cerevisiae) (DCLRE1C) transcript variant a for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d
| Vector | pCMV6 series |
| Tag | Tag Free |
DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant c
| Vector | pCMV6 series |
| Tag | Tag Free |
DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant f
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant h
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant e
| Vector | pCMV6 series |
| Tag | Tag Free |
DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant g
| Vector | pCMV6 series |
| Tag | Tag Free |
Dclre1c (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Dclre1c (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Phospho-Artemis (Ser516) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Artemis around the phosphorylation site of Ser516. AA range:482-531 (Phosphorylated) |
Transient overexpression of DCLRE1C (NM_022487) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- DCLRE1C