Products

cDNA Clones (92)
Proteins (33)
RNAi (11)
Gene Expression (6)
Antibodies (4)
Jump to Filters
View as table Download
PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone
RC223428L3

USD 620.00

8 Weeks

Lenti-ORF clone of PTPN20B (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone Lentiviral Particle
RC223428L3V

USD 820.00

11 Weeks

Lenti ORF particles, PTPN20B (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone
RC223428L4

USD 620.00

8 Weeks

Lenti-ORF clone of PTPN20B (mGFP-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone Lentiviral Particle
RC223428L4V

USD 820.00

11 Weeks

Lenti ORF particles, PTPN20B (mGFP-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone
RC223479

USD 420.00

3 Weeks

PTPN20B (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone
RC223479L3

USD 620.00

8 Weeks

Lenti-ORF clone of PTPN20B (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone Lentiviral Particle
RC223479L3V

USD 820.00

11 Weeks

Lenti ORF particles, PTPN20B (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone
RC223479L4

USD 620.00

8 Weeks

Lenti-ORF clone of PTPN20B (mGFP-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone Lentiviral Particle
RC223479L4V

USD 820.00

11 Weeks

Lenti ORF particles, PTPN20B (mGFP-tagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PTPN20B (PTPN20) (NM_015605) Human Tagged ORF Clone
RG212156

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042358) Human Tagged ORF Clone
RG212270

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042361) Human Tagged ORF Clone
RG212328

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042363) Human Tagged ORF Clone
RG212878

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042357) Human Tagged ORF Clone
RG215748

USD 480.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042359) Human Tagged ORF Clone
RG217930

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042362) Human Tagged ORF Clone
RG218426

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042364) Human Tagged ORF Clone
RG222858

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone
RG223428

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PTPN20B (PTPN20) (NM_001042360) Human Tagged ORF Clone
RG223479

USD 460.00

3 Weeks

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ptpn20 (NM_001080149) Rat Tagged ORF Clone
RR213028

USD 420.00

4 Weeks

Ptpn20b (Myc-DDK-tagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ptpn20 (NM_001080149) Rat Tagged ORF Clone
RR213028L3

USD 640.00

8 Weeks

Lenti ORF clone of Ptpn20b (Myc-DDK-tagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ptpn20 (NM_001080149) Rat Tagged ORF Clone Lentiviral Particle
RR213028L3V

USD 850.00

12 Weeks

Lenti ORF particles, Ptpn20b (Myc-DDK-tagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ptpn20 (NM_001080149) Rat Tagged ORF Clone
RR213028L4

USD 700.00

8 Weeks

Lenti ORF clone of Ptpn20b (mGFP-tagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ptpn20 (NM_001080149) Rat Tagged ORF Clone Lentiviral Particle
RR213028L4V

USD 960.00

12 Weeks

Lenti ORF particles, Ptpn20b (GFP-tagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LOC105369264 (Center) Rabbit Polyclonal Antibody
AP53510PU-N

USD 450.00

2 Weeks

LOC105369264 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 185-215aa) of human PTPN20A.
PTPN20B (PTPN20) (NM_015605) Human Untagged Clone
SC100920

USD 420.00

In Stock

PTPN20B (untagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC100920 is the updated version of SC115097.
PTPN20B (PTPN20) Rabbit Polyclonal Antibody
TA331943

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN20B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN20B Antibody is: synthetic peptide directed towards the N-terminal region of Human PTPN20B. Synthetic peptide located within the following region: ETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGS
Human PTPN20B (PTPN20) activation kit by CRISPRa
GA108749

USD 1,290.00

2 Weeks

PTPN20 CRISPRa kit - CRISPR gene activation of human protein tyrosine phosphatase non-receptor type 20

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PTPN20 Human qPCR Template Standard (NM_015605)
HK210346

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PTPN20B

Application Plasmid of exact quantity for transcript copy number calculation
PTPN20B (PTPN20) Human qPCR Primer Pair (NM_015605)
HP225329

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PTPN20B

PTPN20B (PTPN20) (NM_015605) Human Over-expression Lysate
LC414452

USD 121.00

2 Weeks

PTPN20 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PTPN20B (PTPN20) (NM_001042358) Human Over-expression Lysate
LC420847

USD 121.00

2 Weeks

PTPN20 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PTPN20B (PTPN20) (NM_001042363) Human Over-expression Lysate
LC420852

USD 121.00

2 Weeks

PTPN20 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PTPN20B (PTPN20) (NM_015605) Human Over-expression Lysate
LY414452

USD 396.00

5 Days

Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PTPN20B (PTPN20) (NM_001042358) Human Over-expression Lysate
LY420847

USD 396.00

5 Days

Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PTPN20B (PTPN20) (NM_001042363) Human Over-expression Lysate
LY420852

USD 396.00

5 Days

Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Ptpn20 (NM_008978) Mouse Untagged Clone
MC209261

USD 420.00

4 Weeks

Ptpn20 (untagged) - Mouse protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Ptpn20 Mouse qPCR Primer Pair (NM_008978)
MP212058

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Ptpn20

PTPN20B (PTPN20) (NM_001042363) Human Mass Spec Standard
PH312878

USD 2,055.00

3 Weeks

PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822)

Tag C-Myc/DDK
Expression Host HEK293
Ptpn20 (NM_001080149) Rat Untagged Clone
RN213028

USD 420.00

4 Weeks

Ptpn20b (untagged ORF) - Rat protein tyrosine phosphatase, non-receptor type 20 (Ptpn20), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PTPN20B (PTPN20) (NM_001042360) Human 3' UTR Clone
SC215421

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 5 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042358) Human 3' UTR Clone
SC215423

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042359) Human 3' UTR Clone
SC215426

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 4 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042363) Human 3' UTR Clone
SC215429

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 8 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042357) Human 3' UTR Clone
SC215431

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042361) Human 3' UTR Clone
SC215589

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 6 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_015605) Human 3' UTR Clone
SC215594

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042364) Human 3' UTR Clone
SC215597

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 9 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042362) Human 3' UTR Clone
SC215598

USD 670.00

4 Weeks

3`UTR clone of protein tyrosine phosphatase non-receptor type 20B (PTPN20B) transcript variant 7 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PTPN20B (PTPN20) (NM_001042365) Human Untagged Clone
SC311213

USD 420.00

2 Weeks

PTPN20B (untagged)-Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10

Vector pCMV6 series
Tag Tag Free