Products

cDNA Clones (23)
Antibodies (15)
Proteins (14)
Jump to Filters
View as table Download
SPI1 (NM_001080547) Human Tagged ORF Clone
RC217488

USD 420.00

In Stock

SPI1 (Myc-DDK-tagged)-Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SPI1 (NM_003120) Human Tagged ORF Clone
RC212818

USD 420.00

In Stock

SPI1 (Myc-DDK-tagged)-Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SPI1 (NM_003120) Human Tagged ORF Clone Lentiviral Particle
RC212818L1V

USD 820.00

3 Weeks

Lenti ORF particles, SPI1 (Myc-DDK tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone Lentiviral Particle
RC212818L2V

USD 820.00

6 Weeks

Lenti ORF particles, SPI1 (mGFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone Lentiviral Particle
RC217488L1V

USD 820.00

3 Weeks

Lenti ORF particles, SPI1 (Myc-DDK tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone Lentiviral Particle
RC217488L2V

USD 820.00

3 Weeks

Lenti ORF particles, SPI1 (mGFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone
RG217488

USD 460.00

In Stock

SPI1 (GFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPI1 (NM_001080547) Human Untagged Clone
SC315715

USD 660.00

In Stock

SPI1 (untagged)-Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SPI1 (NM_003120) Human Tagged ORF Clone
RC212818L3

USD 620.00

3 Weeks

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone Lentiviral Particle
RC212818L3V

USD 820.00

5 Weeks

Lenti ORF particles, SPI1 (Myc-DDK tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone
RC212818L4

USD 620.00

3 Weeks

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone Lentiviral Particle
RC212818L4V

USD 820.00

7 Weeks

Lenti ORF particles, SPI1 (mGFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone
RC217488L3

USD 620.00

3 Weeks

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone Lentiviral Particle
RC217488L3V

USD 820.00

7 Weeks

Lenti ORF particles, SPI1 (Myc-DDK tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone
RC217488L4

USD 620.00

In Stock

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_001080547) Human Tagged ORF Clone Lentiviral Particle
RC217488L4V

USD 820.00

3 Weeks

Lenti ORF particles, SPI1 (mGFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone
RG212818

USD 460.00

3 Weeks

SPI1 (GFP-tagged) - Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SPI1 (NM_001080547) Human Tagged ORF Clone
RC217488L1

USD 768.00

In Stock

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SPI1 (NM_003120) Human Tagged ORF Clone
RC212818L1

USD 768.00

In Stock

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SPI1 (NM_003120) Human Untagged Clone
SC127924

USD 660.00

In Stock

SPI1 (untagged)-Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SPI1 Rabbit Polyclonal Antibody
TA347296

USD 358.00

5 Days

Rabbit Polyclonal SPI1 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SPI1 antibody: mouse SPI1 (spleen focus forming virus (SFFV) proviral integration oncogene), using two KLH-conjugated synthetic peptides containing a sequence from the N-terminus and from the C-terminus of the protein, respectively.
SPI1 (NM_001080547) Human Recombinant Protein
TP760680

USD 215.00

In Stock

Purified recombinant protein of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
SPI1 (NM_001080547) Human Tagged ORF Clone
RC217488L2

USD 620.00

In Stock

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SPI1 (NM_003120) Human Untagged Clone
SC317391

USD 660.00

In Stock

SPI1 (untagged)-Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SPI1 (NM_003120) Human Recombinant Protein
TP760228

USD 215.00

In Stock

Recombinant protein of human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
SPI1 (NM_003120) Human Tagged ORF Clone
RC212818L2

USD 620.00

3 Weeks

Lenti ORF clone of Human spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SPI1 Rabbit Polyclonal Antibody
TA324571

USD 450.00

5 Days

Rabbit polyclonal SPI1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SPI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the C-terminal region of human SPI1.
SPI1 Rabbit Polyclonal Antibody
TA326225

USD 345.00

In Stock

Rabbit polyclonal SPI1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human SPI1.
SPI1 (27-37) Goat Polyclonal Antibody
AP22967PU-N

USD 440.00

2 Weeks

SPI1 (27-37) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Equine, Human, Porcine, Rabbit
Immunogen Synthetic peptide from an internal region of human SPI1 / PU.1 (NP_001074016.1; NP_003111.2)
SPI1 (1-122) Rabbit Polyclonal Antibody
AP23158PU-N

USD 440.00

2 Weeks

SPI1 (1-122) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen SPI1 / PU.1 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 122 of Human PU.1
SPI1 (NM_001080547) Human Over-expression Lysate
LC421101

USD 121.00

In Stock

SPI1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPI1 (NM_001080547) Human Over-expression Lysate
LY421101

USD 396.00

5 Days

Transient overexpression lysate of spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPI1 Goat Polyclonal Antibody
TA303347

USD 375.00

5 Days

Goat Polyclonal Antibody against SPI1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLYQRQTHEYY, from the internal region of the protein sequence according to NP_001074016.1; NP_003111.2.
SPI1 (NM_003120) Human Over-expression Lysate
LY418885

USD 396.00

5 Days

Transient overexpression lysate of spleen focus forming virus (SFFV) proviral integration oncogene spi1 (SPI1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPI1 Rabbit Monoclonal Antibody [Clone ID: EPR3158Y]
TA327731

USD 1,005.00

5 Days

Rabbit Monoclonal PU.1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
SPI1 Rabbit Polyclonal Antibody
TA329273

USD 375.00

5 Days

Rabbit Polyclonal anti-SPI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH
SPI1 Rabbit Polyclonal Antibody
TA329274

USD 375.00

5 Days

Rabbit Polyclonal anti-SPI1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPI1 antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: HPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGL
SPI1 Rabbit Polyclonal Antibody
TA335785

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER
SPI1 / PU.1 (1-271, His-tag) Human Protein
AR51789PU-N

USD 845.00

2 Weeks

SPI1 / PU.1 (1-271, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
SPI1 / PU.1 (1-271, His-tag) Human Protein
AR51789PU-S

USD 330.00

2 Weeks

SPI1 / PU.1 (1-271, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
SPI1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF808850

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SPI1 mouse monoclonal antibody,clone OTI1F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SPI1 (NM_003120) Human Over-expression Lysate
LC418885

USD 121.00

2 Weeks

SPI1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SPI1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]
TA808850

USD 379.00

In Stock

SPI1 mouse monoclonal antibody,clone OTI1F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SPI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]
TA808850AM

USD 420.00

4 Weeks

SPI1 mouse monoclonal antibody,clone OTI1F3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
SPI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F3]
TA808850BM

USD 420.00

4 Weeks

SPI1 mouse monoclonal antibody,clone OTI1F3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
SPI1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]
TA808850S

USD 159.00

2 Days

SPI1 mouse monoclonal antibody,clone OTI1F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SPI1 (NM_003120) ICC Control Block
TB412818

USD 1,070.00

4 Weeks

Transient overexpression of SPI1 (NM_003120) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPI1 (NM_001080547) ICC Control Block
TB417488

USD 1,070.00

4 Weeks

Transient overexpression of SPI1 (NM_001080547) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SPI1 Cytosection
TS412818

USD 225.00

4 Weeks

Transient overexpression of SPI1 (NM_003120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SPI1 Cytosection
TS412818P5

USD 889.00

4 Weeks

Transient overexpression of SPI1 (NM_003120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack