Products

cDNA Clones (30)
Proteins (18)
Antibodies (6)
Jump to Filters
View as table Download
BACE2 (NM_012105) Human Tagged ORF Clone
RC204860

USD 420.00

In Stock

BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BACE2 (NM_012105) Human Recombinant Protein
TP304860

USD 867.00

In Stock

Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
BACE2 (NM_012105) Human Tagged ORF Clone Lentiviral Particle
RC204860L1V

USD 820.00

3 Weeks

Lenti ORF particles, BACE2 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BACE2 (NM_012105) Human Tagged ORF Clone Lentiviral Particle
RC204860L2V

USD 820.00

6 Weeks

Lenti ORF particles, BACE2 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone Lentiviral Particle
RC213667L1V

USD 820.00

3 Weeks

Lenti ORF particles, BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone Lentiviral Particle
RC213667L2V

USD 820.00

6 Weeks

Lenti ORF particles, BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone
RC213667

USD 420.00

In Stock

BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE2 (NM_012105) Human Tagged ORF Clone
RG204860

USD 460.00

In Stock

BACE2 (GFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE2 (NM_012105) Human Tagged ORF Clone
RC204860L3

USD 620.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_012105) Human Tagged ORF Clone Lentiviral Particle
RC204860L3V

USD 820.00

5 Weeks

Lenti ORF particles, BACE2 (Myc-DDK tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_012105) Human Tagged ORF Clone Lentiviral Particle
RC204860L4V

USD 820.00

3 Weeks

Lenti ORF particles, BACE2 (mGFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone
RC213667L3

USD 620.00

3 Weeks

Lenti-ORF clone of BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone Lentiviral Particle
RC213667L3V

USD 820.00

11 Weeks

Lenti ORF particles, BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone
RC213667L4

USD 620.00

3 Weeks

Lenti-ORF clone of BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone Lentiviral Particle
RC213667L4V

USD 820.00

11 Weeks

Lenti ORF particles, BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138991) Human Tagged ORF Clone
RC224623

USD 430.00

2 Weeks

BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE2 (NM_138991) Human Tagged ORF Clone
RC224623L3

USD 630.00

8 Weeks

Lenti-ORF clone of BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138991) Human Tagged ORF Clone Lentiviral Particle
RC224623L3V

USD 830.00

11 Weeks

Lenti ORF particles, BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138991) Human Tagged ORF Clone
RC224623L4

USD 630.00

8 Weeks

Lenti-ORF clone of BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138991) Human Tagged ORF Clone Lentiviral Particle
RC224623L4V

USD 830.00

11 Weeks

Lenti ORF particles, BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone
RG213667

USD 460.00

3 Weeks

BACE2 (GFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE2 (NM_138991) Human Tagged ORF Clone
RG224623

USD 470.00

5 Weeks

BACE2 (GFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BACE2 (NM_012105) Human Tagged Lenti ORF Clone
RC204860L1

USD 768.00

In Stock

Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BACE2 (NM_138992) Human Tagged Lenti ORF Clone
RC213667L1

USD 768.00

In Stock

Lenti-ORF clone of BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BACE2 (NM_012105) Human Tagged ORF Clone
RC204860L4

USD 768.00

In Stock

Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BACE2 (NM_012105) Human Untagged Clone
SC110343

USD 310.00

2 Weeks

BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BACE2 (NM_012105) Human Untagged Clone
SC320428

USD 310.00

In Stock

BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC320428 is the updated version of SC125391.
BACE2 Rabbit Polyclonal Antibody
TA306031

USD 430.00

In Stock

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2.
BACE2 (44-59) Rabbit Polyclonal Antibody
AP22917PU-N

USD 525.00

2 Weeks

BACE2 (44-59) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen BACE2 antibody was raised against synthetic peptide (aptpgpgtpaerhadg) corresponding to amino acids 44 to 59 of human BACE2
BACE2 (NM_012105) Human Tagged ORF Clone
RC204860L2

USD 620.00

3 Weeks

Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BACE2 (NM_138992) Human Tagged ORF Clone
RC213667L2

USD 620.00

3 Weeks

Lenti-ORF clone of BACE2 (mGFP-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BACE2 (NM_138992) Human Over-expression Lysate
LC408427

USD 121.00

In Stock

BACE2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE2 (NM_012105) Human Over-expression Lysate
LC415975

USD 121.00

In Stock

BACE2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE2 (N-term) Rabbit Polyclonal Antibody
RA25043-50

USD 450.00

2 Weeks

BACE2 (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BACE2 (NM_138991) Human Untagged Clone
SC126981

USD 780.00

In Stock

BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
BACE2 (NM_138992) Human Untagged Clone
SC127678

USD 680.00

In Stock

BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BACE2 Rabbit Polyclonal Antibody
TA306032

USD 430.00

5 Days

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BACE2.
BACE2 Rabbit Polyclonal Antibody
TA341893

USD 375.00

5 Days

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
BACE2 Rabbit Polyclonal Antibody
TA341894

USD 375.00

5 Days

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
BACE2 (NM_138991) Human Over-expression Lysate
LC408426

USD 187.00

2 Weeks

BACE2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE2 (NM_138991) Human Over-expression Lysate
LC430078

USD 121.00

2 Weeks

BACE2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BACE2 (NM_138991) Human Over-expression Lysate
LY408426

USD 605.00

5 Days

Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY408426 is the same product as LY430078.
BACE2 (NM_012105) Human Mass Spec Standard
PH304860

USD 2,055.00

3 Weeks

BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)

Tag C-Myc/DDK
Expression Host HEK293
BACE2 (NM_012105) ICC Control Block
TB404860

USD 1,070.00

4 Weeks

Transient overexpression of BACE2 (NM_012105) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BACE2 (NM_138992) ICC Control Block
TB413667

USD 1,070.00

4 Weeks

Transient overexpression of BACE2 (NM_138992) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BACE2 (NM_138991) ICC Control Block
TB424623

USD 1,080.00

4 Weeks

Transient overexpression of BACE2 (NM_138991) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BACE2 Cytosection
TS404860

USD 225.00

4 Weeks

Transient overexpression of BACE2 (NM_012105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack