Germany
Japan
United Kingdom
China
PSENEN (Myc-DDK-tagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PSENEN (myc-DDK-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSENEN (GFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PSENEN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal PSENEN/PEN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PEN2 (within residues 50-101). [UniProt# Q9NZ42] |
Rabbit Polyclonal Anti-PSENEN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT |
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PSENEN (GFP-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSENEN (untagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSENEN
Pathways
- Alzheimer's disease