Products

View as table Download

DAXX (Myc-DDK-tagged)-Human death-domain associated protein (DAXX), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

DAXX (Myc-DDK-tagged)-Human death-domain associated protein (DAXX), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

DAXX (Myc-DDK-tagged)-Human death-domain associated protein (DAXX), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, DAXX (Myc-DDK tagged) - Human death-domain associated protein (DAXX), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, DAXX (mGFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, DAXX (Myc-DDK tagged) - Human death-domain associated protein (DAXX), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, DAXX (mGFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

DAXX (GFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DAXX (GFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (Myc-DDK tagged) - Human death-domain associated protein (DAXX), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (mGFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (Myc-DDK tagged) - Human death-domain associated protein (DAXX), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (mGFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (Myc-DDK tagged) - Human death-domain associated protein (DAXX), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DAXX (mGFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DAXX (Myc-DDK tagged) - Homo sapiens death-domain associated protein (DAXX), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DAXX (GFP-tagged) - Human death-domain associated protein (DAXX), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DAXX (GFP-tagged) - Homo sapiens death-domain associated protein (DAXX), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DAXX (untagged)-Human death-domain associated protein (DAXX), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Monoclonal Antibody against DAXX (Clone E94)

Applications FC, IHC, WB
Reactivities Human

DAXX rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human death-domain associated protein (DAXX), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

DAXX (untagged)-Human death-domain associated protein (DAXX), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

DAXX HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

DAXX HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Daxx Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Daxx antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Daxx. The immunogen is located within the last 50 amino acids of Daxx.

Rabbit polyclonal anti-DAXX antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 261-274 of human DAXX protein.

Rabbit Polyclonal Anti-DAXX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAXX antibody is: synthetic peptide directed towards the C-terminal region of Human DAXX. Synthetic peptide located within the following region: VSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHE

DAXX HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341)

Tag C-Myc/DDK
Expression Host HEK293

DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135441)

Tag C-Myc/DDK
Expression Host HEK293

DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442)

Tag C-Myc/DDK
Expression Host HEK293

DAXX (untagged)-Human death-domain associated protein (DAXX), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

DAXX (untagged) - Homo sapiens death-domain associated protein (DAXX), transcript variant 4

Vector pCMV6 series
Tag Tag Free

USD 1,070.00

4 Weeks

Transient overexpression of DAXX (NM_001350) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of DAXX (NM_001141969) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,480.00

4 Weeks

Transient overexpression of DAXX (NM_001141970) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,350.00

4 Weeks

Transient overexpression of DAXX (NM_001254717) in HEK293T cells paraffin embedded controls for ICC/IHC staining