Germany
Japan
United Kingdom
China
GTF2E2 (Myc-DDK-tagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GTF2E2 (GFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GTF2E2 (Myc-DDK tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GTF2E2 (mGFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GTF2E2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-GTF2E2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG |
Rabbit Polyclonal Anti-GTF2E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG |
Rabbit Polyclonal Anti-GTF2E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the middle region of human GTF2E2. Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK |
GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GTF2E2
Pathways
- Basal transcription factors