Products

cDNA Clones (34)
RNAi (12)
Antibodies (7)
Proteins (7)
Gene Expression (6)
Jump to Filters
View as table Download
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477

USD 420.00

In Stock

GTF2E2 (Myc-DDK-tagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone
MR204019

USD 68.00

USD 149.00

In Stock

Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RG203477

USD 460.00

In Stock

GTF2E2 (GFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 Mouse Gene Knockout Kit (CRISPR)
KN507418

USD 1,290.00

2 Weeks

Gtf2e2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507418 is the updated version of KN307418.
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone
MG204019

USD 300.00

3 Weeks

Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone
MG218407

USD 300.00

3 Weeks

Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E polypeptide 2 (beta subunit) (Gtf2e2) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone
MG219093

USD 300.00

3 Weeks

Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E polypeptide 2 (beta subunit) (Gtf2e2) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone
MR204019L3

USD 500.00

3 Weeks

Lenti ORF clone of Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone Lentiviral Particle
MR204019L3V

USD 700.00

6 Weeks

Lenti ORF particles, Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone
MR204019L4

USD 500.00

3 Weeks

Lenti ORF clone of Gtf2e2 (mGFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_026584) Mouse Tagged ORF Clone Lentiviral Particle
MR204019L4V

USD 700.00

6 Weeks

Lenti ORF particles, Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone
MR218407

USD 330.00

2 Weeks

Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone
MR218407L3

USD 500.00

8 Weeks

Lenti ORF clone of Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone Lentiviral Particle
MR218407L3V

USD 700.00

11 Weeks

Lenti ORF particles, Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone
MR218407L4

USD 500.00

8 Weeks

Lenti ORF clone of Gtf2e2 (mGFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167921) Mouse Tagged ORF Clone Lentiviral Particle
MR218407L4V

USD 700.00

11 Weeks

Lenti ORF particles, Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone
MR219093

USD 330.00

2 Weeks

Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone
MR219093L3

USD 500.00

3 Weeks

Lenti ORF clone of Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone Lentiviral Particle
MR219093L3V

USD 700.00

6 Weeks

Lenti ORF particles, Gtf2e2 (Myc-DDK-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone
MR219093L4

USD 500.00

3 Weeks

Lenti ORF clone of Gtf2e2 (mGFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001167922) Mouse Tagged ORF Clone Lentiviral Particle
MR219093L4V

USD 700.00

6 Weeks

Lenti ORF particles, Gtf2e2 (GFP-tagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (Gtf2e2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477L3

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone Lentiviral Particle
RC203477L3V

USD 820.00

6 Weeks

Lenti ORF particles, GTF2E2 (Myc-DDK tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477L4

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone Lentiviral Particle
RC203477L4V

USD 820.00

6 Weeks

Lenti ORF particles, GTF2E2 (mGFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001107318) Rat Tagged ORF Clone
RR212925

USD 420.00

4 Weeks

Gtf2e2 (Myc-DDK-tagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2e2 (NM_001107318) Rat Tagged ORF Clone
RR212925L3

USD 640.00

8 Weeks

Lenti ORF clone of Gtf2e2 (Myc-DDK-tagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001107318) Rat Tagged ORF Clone Lentiviral Particle
RR212925L3V

USD 850.00

12 Weeks

Lenti ORF particles, Gtf2e2 (Myc-DDK-tagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001107318) Rat Tagged ORF Clone
RR212925L4

USD 700.00

8 Weeks

Lenti ORF clone of Gtf2e2 (mGFP-tagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2e2 (NM_001107318) Rat Tagged ORF Clone Lentiviral Particle
RR212925L4V

USD 960.00

12 Weeks

Lenti ORF particles, Gtf2e2 (GFP-tagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Untagged Clone
SC118828

USD 310.00

In Stock

GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA313982

USD 345.00

In Stock

Rabbit polyclonal anti-TF2E2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TF2E2.
TFIIE beta (GTF2E2) (NM_002095) Human Untagged Clone
SC320510

USD 310.00

In Stock

GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIE beta (GTF2E2) (NM_002095) Human Over-expression Lysate
LC419544

USD 121.00

In Stock

GTF2E2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Gtf2e2 (BC020016) Mouse Untagged Clone
MC206311

USD 210.00

In Stock

Gtf2e2 (untagged) - Mouse general transcription factor II E, polypeptide 2 (beta subunit) (cDNA clone MGC:29023 IMAGE:3501113), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA329281

USD 375.00

5 Days

Rabbit Polyclonal anti-GTF2E2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA335216

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA335217

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the middle region of human GTF2E2. Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
GTF2E2 / TF2E2 (1-291, His-tag) Human Protein
AR50371PU-N

USD 1,105.00

2 Weeks

GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
GTF2E2 / TF2E2 (1-291, His-tag) Human Protein
AR50371PU-S

USD 415.00

2 Weeks

GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human TFIIE beta (GTF2E2) activation kit by CRISPRa
GA102006

USD 1,290.00

2 Weeks

GTF2E2 CRISPRa kit - CRISPR gene activation of human general transcription factor IIE subunit 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gtf2e2 activation kit by CRISPRa
GA207700

USD 1,290.00

2 Weeks

Gtf2e2 CRISPRa kit - CRISPR gene activation of mouse general transcription factor II E, polypeptide 2 (beta subunit)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
TFIIE beta (GTF2E2) Human qPCR Template Standard (NM_002095)
HK203563

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GTF2E2

Application Plasmid of exact quantity for transcript copy number calculation
TFIIE beta (GTF2E2) Human qPCR Primer Pair (NM_002095)
HP205836

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GTF2E2

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Gtf2e2 Mouse qPCR Primer Pair (NM_026584)
MP205412

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gtf2e2

Gtf2e2 (NM_001107318) Rat Untagged Clone
RN212925

USD 420.00

4 Weeks

Gtf2e2 (untagged ORF) - Rat general transcription factor IIE, polypeptide 2, beta (Gtf2e2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIE beta (GTF2E2) (NM_002095) Human 3' UTR Clone
SC205819

USD 560.00

4 Weeks

3`UTR clone of general transcription factor IIE polypeptide 2 beta 34kDa (GTF2E2) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
GTF2E2 Human siRNA Oligo Duplex (Locus ID 2961)
SR302002

USD 430.00

2 Weeks

GTF2E2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Gtf2e2 Mouse siRNA Oligo Duplex (Locus ID 68153)
SR408419

USD 430.00

2 Weeks

Gtf2e2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).