Germany
Japan
United Kingdom
China
TGFB1 (untagged)-Human transforming growth factor, beta 1 (TGFB1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadTGFB1 (Myc-DDK-tagged)-Human transforming growth factor, beta 1 (TGFB1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human transforming growth factor, beta 1 (TGFB1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TGFB1 (GFP-tagged) - Human transforming growth factor, beta 1 (TGFB1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (Myc-DDK tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (mGFP-tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (Myc-DDK tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TGFB1 (mGFP-tagged) - Human transforming growth factor, beta 1 (TGFB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
| Tag | tag free |
| Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1).
| Tag | Tag Free |
| Expression Host | HEK293 |
Lenti ORF clone of Human transforming growth factor, beta 1 (TGFB1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Lenti ORF clone of Human transforming growth factor, beta 1 (TGFB1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1).
| Tag | Tag Free |
| Expression Host | CHO |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
| Tag | Tag Free |
| Expression Host | CHO |
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-Tgfb1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV |
Rabbit polyclonal TGF beta 1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length). |
Rabbit anti TGF beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |
Rabbit anti TGF beta 1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A Recombinant protein encoding human TGF beta 1 aa 177-391 expressed in E.Coli. |
TGFB1 (279-390) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
TGFB1 (279-390) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFB1 MS Standard C13 and N15-labeled recombinant protein (NP_000651)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
| Tag | tag free |
| Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
| Tag | tag free |
| Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1)
| Tag | tag free |
| Expression Host | HEK293 |
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TGFB1 (NM_000660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TGFB1
Pathways
- Chronic myeloid leukemia