C1R (Myc-DDK-tagged)-Human complement component 1, r subcomponent (C1R)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
C1R (Myc-DDK-tagged)-Human complement component 1, r subcomponent (C1R)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, C1R (Myc-DDK tagged) - Human complement component 1, r subcomponent (C1R), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, C1R (mGFP-tagged) - Human complement component 1, r subcomponent (C1R), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
C1R (GFP-tagged) - Human complement component 1, r subcomponent (C1R)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human complement component 1, r subcomponent (C1R), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, C1R (Myc-DDK tagged) - Human complement component 1, r subcomponent (C1R), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human complement component 1, r subcomponent (C1R), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, C1R (mGFP-tagged) - Human complement component 1, r subcomponent (C1R), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human complement component 1, r subcomponent (C1R), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human complement component 1, r subcomponent (C1R), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
C1R (untagged)-Human complement component 1, r subcomponent (C1R)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
C1R rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from Human C1R. Epitope: Amino Acids 445-494. |
C1R goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | The subunit C1r is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human C1R. |
C1R HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of complement component 1, r subcomponent (C1R)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-C1R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ |
Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody,clone 5A11, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
C1R mouse monoclonal antibody,clone 5A11, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
C1R mouse monoclonal antibody,clone 1F1, Biotinylated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
C1R mouse monoclonal antibody,clone 1F1, HRP conjugated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | HRP |
C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Transient overexpression of C1R (NM_001733) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of C1R (NM_001733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of C1R (NM_001733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack