Products

View as table Download

PROC (Myc-DDK-tagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)

Tag C-Myc/DDK
Expression Host HEK293T

PROC (GFP-tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PROC (Myc-DDK tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PROC (mGFP-tagged) - Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PROC (untagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD

Rabbit anti-PROC Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PROC

PROC (untagged)-Human protein C (inactivator of coagulation factors Va and VIIIa) (cDNA clone MGC:34565 IMAGE:5188604), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL

Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Protein C (PROC) mouse monoclonal antibody, clone CaC-11, Purified

Applications ELISA, WB
Reactivities Human

PROC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Protein C (PROC) mouse monoclonal antibody, clone HLW-C, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to Protein C (protein C (inactivator of coagulation factors Va and VIIIa))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 145 and 461 of Protein C (Uniprot ID#P04070)

Rabbit polyclonal PROC (light chain, Cleaved-Leu179) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PROC.

PROC MS Standard C13 and N15-labeled recombinant protein (NP_000303)

Tag C-Myc/DDK
Expression Host HEK293

PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PROC (NM_000312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack