Germany
Japan
United Kingdom
China
IL21 (Myc-DDK-tagged)-Human interleukin 21 (IL21), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, IL21 (Myc-DDK tagged) - Human interleukin 21 (IL21), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IL21 (mGFP-tagged) - Human interleukin 21 (IL21), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IL21 (GFP-tagged) - Human interleukin 21 (IL21), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human interleukin 21 (IL21), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL21 (Myc-DDK tagged) - Human interleukin 21 (IL21), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 21 (IL21), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL21 (mGFP-tagged) - Human interleukin 21 (IL21), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL21 (Myc-DDK tagged) - Homo sapiens interleukin 21 (IL21), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL21 (GFP-tagged) - Homo sapiens interleukin 21 (IL21), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL21 (untagged)-Human interleukin 21 (IL21), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human interleukin 21 (IL21), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IL-21 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor . |
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1
| Tag | Tag Free |
| Expression Host | E. coli |
IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1
| Tag | tag free |
| Expression Host | HEK293 |
Lenti ORF clone of Human interleukin 21 (IL21), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IL21 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of interleukin 21 (IL21)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-IL21 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IL21. |
Mouse Polyclonal IL-21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full-length human IL-21 |
Rabbit Polyclonal Anti-IL21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS |
IL21 (untagged) - Homo sapiens interleukin 21 (IL21), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of IL21 (NM_021803) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL21 (NM_001207006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1
| Tag | tag free |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1
| Tag | tag free |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1
| Tag | tag free |
| Expression Host | HEK293 |
Transient overexpression of IL21 (NM_021803) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL21 (NM_021803) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL21 (NM_001207006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IL21
Pathways
- Cytokine-cytokine receptor interaction