PDGFB (Myc-DDK-tagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFB (Myc-DDK-tagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
2 Weeks
Lenti ORF particles, PDGFB (mGFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
3 Weeks
Lenti ORF particles, PDGFB (mGFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,020.00
6 Weeks
Lenti ORF particles, PDGFB (Myc-DDK tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,020.00
6 Weeks
Lenti ORF particles, PDGFB (Myc-DDK tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PDGFB (Myc-DDK-tagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFB (GFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDGFB (untagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFB (Myc-DDK tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFB (mGFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDGFB (GFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit anti-PDGFB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFB |
Transient overexpression lysate of platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Purified recombinant protein of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1.
Tag | Tag Free |
Expression Host | E. coli |
PDGFB (PDGF-BB) human recombinant protein, 20 µg
Expression Host | E. coli |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-BB. |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bovine, Human, Sheep |
Immunogen | Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1) |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
PDGFB (untagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PDGFB (PDGF-BB) human recombinant protein, 5 µg
Expression Host | E. coli |
PDGFB (PDGF-BB) human recombinant protein, 2 µg
Expression Host | E. coli |
Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-BB. |
Anti-Human PDGF-BB Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-BB |
PDGFB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-PDGFB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PDGFB. |
Rabbit Polyclonal PDGF-B Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal PDGF-B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PDGF-B. |
Biotinylated Anti-Human PDGF-BB Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-BB |
Rabbit Polyclonal PDGFB Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
PDGFB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-PDGF-BB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human PDGF-BB |
Rabbit polyclonal anti-PDGF-BB antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli expressed murine PDGF-BB |
Rabbit Polyclonal PDGFB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human PDGFB. |
PDGFB (82-190, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
PDGFB (82-190, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
PDGFB (untagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-PDGFB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-115 amino acids of Human platelet-derived growth factor beta polypeptide |
Transient overexpression of PDGFB (NM_002608) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFB (NM_033016) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1
Tag | tag free |
Expression Host | E. coli |