Products

cDNA Clones (23)
Antibodies (19)
Proteins (18)
Jump to Filters
View as table Download
L Kynurenine Hydrolase (KYNU) (NM_001199241) Human Tagged ORF Clone
RC232794

USD 420.00

In Stock

KYNU (Myc-DDK tagged) - Homo sapiens kynureninase (KYNU), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Tagged ORF Clone Lentiviral Particle
RC201559L3V

USD 820.00

7 Weeks

Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Tagged ORF Clone Lentiviral Particle
RC214932L3V

USD 820.00

3 Weeks

Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Untagged Clone
SC317002

USD 780.00

In Stock

KYNU (untagged)-Human kynureninase (KYNU), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA308219

USD 415.00

5 Days

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA338980

USD 375.00

5 Days

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Over-expression Lysate
LC418347

USD 187.00

In Stock

KYNU HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Over-expression Lysate
LC422334

USD 121.00

In Stock

KYNU HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Over-expression Lysate
LC429170

USD 121.00

In Stock

KYNU HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Over-expression Lysate
LY422334

USD 396.00

In Stock

Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
L Kynurenine Hydrolase (KYNU) (C-term) Rabbit Polyclonal Antibody
AP17533PU-N

USD 450.00

2 Weeks

L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU
L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
TA338979

USD 310.00

5 Days

Rabbit Polyclonal Anti-KYNU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
CF803959

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI5E4]
CF804063

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Over-expression Lysate
LY418347

USD 605.00

5 Days

Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY418347 is the same product as LY429170.
L Kynurenine Hydrolase (KYNU) (NM_003937) Human Over-expression Lysate
LY429170

USD 396.00

5 Days

Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
TA803959

USD 379.00

In Stock

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA803959AM

USD 420.00

4 Weeks

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated

Applications IHC
Reactivities Human, Rat
Conjugation Biotin
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]
TA803959BM

USD 420.00

4 Weeks

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated

Applications IHC
Reactivities Human, Rat
Conjugation HRP
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
TA803959S

USD 159.00

2 Days

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E4]
TA804063AM

USD 420.00

4 Weeks

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated

Applications IHC, WB
Reactivities Human, Rat
Conjugation Biotin
L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E4]
TA804063BM

USD 420.00

4 Weeks

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated

Applications IHC, WB
Reactivities Human, Rat
Conjugation HRP