KYNU (Myc-DDK-tagged)-Human kynureninase (KYNU), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KYNU (Myc-DDK-tagged)-Human kynureninase (KYNU), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KYNU (Myc-DDK-tagged)-Human kynureninase (KYNU), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
6 Weeks
Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, KYNU (mGFP-tagged) - Human kynureninase (KYNU), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, KYNU (mGFP-tagged) - Human kynureninase (KYNU), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
KYNU (GFP-tagged) - Human kynureninase (KYNU), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KYNU (Myc-DDK tagged) - Homo sapiens kynureninase (KYNU), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KYNU (GFP-tagged) - Human kynureninase (KYNU), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, KYNU (mGFP-tagged) - Human kynureninase (KYNU), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, KYNU (Myc-DDK tagged) - Human kynureninase (KYNU), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, KYNU (mGFP-tagged) - Human kynureninase (KYNU), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
KYNU (GFP-tagged) - Homo sapiens kynureninase (KYNU), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KYNU (untagged)-Human kynureninase (KYNU), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human kynureninase (KYNU), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
KYNU (untagged)-Human kynureninase (KYNU), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719) |
Rabbit Polyclonal Anti-KYNU Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP |
KYNU HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 121.00
In Stock
KYNU HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KYNU HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU |
Rabbit Polyclonal Anti-KYNU Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
KYNU (untagged) - Homo sapiens kynureninase (KYNU), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
USD 379.00
In Stock
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 159.00
2 Days
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 159.00
2 Days
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |