Products

cDNA Clones (29)
Proteins (24)
Antibodies (23)
Jump to Filters
View as table Download
PAICS (NM_001079525) Human Tagged ORF Clone
RC223925

USD 420.00

In Stock

PAICS (Myc-DDK-tagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAICS (NM_006452) Human Tagged ORF Clone
RC215225

USD 420.00

In Stock

PAICS (Myc-DDK-tagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAICS (NM_001079524) Human Tagged ORF Clone
RC201530

USD 420.00

In Stock

PAICS (Myc-DDK-tagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAICS (NM_001079524) Human Recombinant Protein
TP301530

USD 867.00

In Stock

Recombinant protein of human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

PAICS (NM_006452) Human Tagged ORF Clone Lentiviral Particle
RC215225L2V

USD 820.00

3 Weeks

Lenti ORF particles, PAICS (mGFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone Lentiviral Particle
RC215225L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAICS (Myc-DDK tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone Lentiviral Particle
RC223925L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAICS (Myc-DDK tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone Lentiviral Particle
RC223925L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAICS (mGFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone
RG215225

USD 460.00

In Stock

PAICS (GFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAICS (NM_001079525) Human Tagged ORF Clone
RG223925

USD 460.00

2 Weeks

PAICS (GFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAICS (NM_001079524) Human Tagged ORF Clone
RC201530L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079524) Human Tagged ORF Clone Lentiviral Particle
RC201530L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAICS (Myc-DDK tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079524) Human Tagged ORF Clone
RC201530L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079524) Human Tagged ORF Clone Lentiviral Particle
RC201530L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAICS (mGFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone
RC215225L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone Lentiviral Particle
RC215225L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAICS (Myc-DDK tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone
RC215225L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone Lentiviral Particle
RC215225L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAICS (mGFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone
RC223925L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone Lentiviral Particle
RC223925L3V

USD 820.00

7 Weeks

Lenti ORF particles, PAICS (Myc-DDK tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone
RC223925L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079525) Human Tagged ORF Clone Lentiviral Particle
RC223925L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAICS (mGFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAICS (NM_001079524) Human Tagged ORF Clone
RG201530

USD 460.00

3 Weeks

PAICS (GFP-tagged) - Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAICS (NM_001079525) Human Tagged Lenti ORF Clone
RC223925L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone
RC215225L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAICS (NM_006452) Human Tagged ORF Clone
RC215225L2

USD 768.00

In Stock

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAICS (N-term) Rabbit Polyclonal Antibody
AP53152PU-N

USD 450.00

2 Weeks

PAICS (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 94-123 amino acids from the N-terminal region of human PAICS
PAICS (NM_006452) Human Over-expression Lysate
LY416636

USD 396.00

In Stock

Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079525) Human Over-expression Lysate
LY421515

USD 605.00

In Stock

Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421515 is the same product as LY425884.
PAICS (NM_001079525) Human Tagged ORF Clone
RC223925L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAICS (NM_006452) Human Untagged Clone
SC111158

USD 310.00

In Stock

PAICS (untagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAICS (NM_001079524) Human Untagged Clone
SC323928

USD 760.00

In Stock

PAICS (untagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PAICS (NM_006452) Human Over-expression Lysate
LC416636

USD 121.00

In Stock

PAICS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079525) Human Over-expression Lysate
LC421515

USD 187.00

In Stock

PAICS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS Rabbit Polyclonal Antibody
TA338988

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAICS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAICS antibody: synthetic peptide directed towards the N terminal of human PAICS. Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
PAICS / ADE2 (1-425, His-tag) Human Protein
AR51448PU-N

USD 845.00

2 Weeks

PAICS / ADE2 (1-425, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PAICS / ADE2 (1-425, His-tag) Human Protein
AR51448PU-S

USD 330.00

2 Weeks

PAICS / ADE2 (1-425, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PAICS Mouse Monoclonal Antibody [Clone ID: OTI5B6]
CF501469

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAICS Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF501470

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAICS Mouse Monoclonal Antibody [Clone ID: OTI8A1]
CF501471

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAICS Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF501485

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAICS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAICS (NM_001079524) Human Over-expression Lysate
LC421514

USD 121.00

2 Weeks

PAICS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079524) Human Over-expression Lysate
LC425883

USD 121.00

2 Weeks

PAICS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079525) Human Over-expression Lysate
LC425884

USD 121.00

2 Weeks

PAICS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079524) Human Over-expression Lysate
LY421514

USD 396.00

5 Days

Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421514 is the same product as LY425883.
PAICS (NM_001079524) Human Over-expression Lysate
LY425883

USD 396.00

5 Days

Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079525) Human Over-expression Lysate
LY425884

USD 396.00

5 Days

Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAICS (NM_001079524) Human Mass Spec Standard
PH301530

USD 2,055.00

3 Weeks

PAICS MS Standard C13 and N15-labeled recombinant protein (NP_001072992)

Tag C-Myc/DDK
Expression Host HEK293
PAICS (NM_006452) Human Mass Spec Standard
PH315225

USD 2,055.00

3 Weeks

PAICS MS Standard C13 and N15-labeled recombinant protein (NP_006443)

Tag C-Myc/DDK
Expression Host HEK293
PAICS (NM_001079525) Human Untagged Clone
SC315553

USD 730.00

3 Weeks

PAICS (untagged)-Human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin