Products

cDNA Clones (10)
Antibodies (9)
Proteins (7)
Jump to Filters
View as table Download
C5R1 (C5AR1) (NM_001736) Human Tagged ORF Clone
RC203784

USD 420.00

In Stock

C5AR1 (Myc-DDK-tagged)-Human complement component 5a receptor 1 (C5AR1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
C5R1 (C5AR1) (NM_001736) Human Tagged ORF Clone
RG203784

USD 460.00

In Stock

C5AR1 (GFP-tagged) - Human complement component 5a receptor 1 (C5AR1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C5R1 (C5AR1) (NM_001736) Human Untagged Clone
SC119072

USD 310.00

In Stock

C5AR1 (untagged)-Human complement component 5a receptor 1 (C5AR1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
C5R1 (C5AR1) (NM_001736) Human Tagged ORF Clone
RC203784L1

USD 768.00

In Stock

Lenti ORF clone of Human complement component 5a receptor 1 (C5AR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
C5R1 (C5AR1) (NM_001736) Human Untagged Clone
SC322253

USD 760.00

In Stock

C5AR1 (untagged)-Human complement component 5a receptor 1 (C5AR1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
C5R1 (C5AR1) (NM_001736) Human Over-expression Lysate
LY400657

USD 396.00

5 Days

Transient overexpression lysate of complement component 5a receptor 1 (C5AR1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
C5R1 (C5AR1) Mouse Monoclonal Antibody [Clone ID: 3H1738]
AM20489PU-N

USD 440.00

2 Weeks

C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified

Applications FC, FN, IHC, NEUT
Reactivities Human, Rabbit
C5R1 (C5AR1) (NM_001736) Human Tagged ORF Clone
RC203784L2

USD 620.00

3 Weeks

Lenti ORF clone of Human complement component 5a receptor 1 (C5AR1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
C5R1 (C5AR1) (Center) Rabbit Polyclonal Antibody
AP50640PU-N

USD 450.00

2 Weeks

C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1
C5R1 (C5AR1) (NM_001736) Human Over-expression Lysate
LC400657

USD 121.00

In Stock

C5AR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA328617

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus.
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA340920

USD 425.00

5 Days

Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%).
C5R1 (C5AR1) Rat Monoclonal Antibody [Clone ID: 8D6]
AM31865BT-N

USD 280.00

2 Weeks

C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Biotin

Applications FC
Reactivities Human
Conjugation Biotin
C5R1 (C5AR1) Rat Monoclonal Antibody [Clone ID: 8D6]
AM31865FC-N

USD 300.00

2 Weeks

C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, FITC

Applications FC
Reactivities Human
Conjugation FITC
C5R1 (C5AR1) Rat Monoclonal Antibody [Clone ID: 8D6]
AM31865PU-N

USD 435.00

2 Weeks

C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Purified

Applications FC
Reactivities Human
C5R1 (C5AR1) Rat Monoclonal Antibody [Clone ID: 8D6]
AM31865RP-N

USD 260.00

2 Weeks

C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, PE

Applications FC
Reactivities Human
Conjugation PE
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA342835

USD 375.00

5 Days

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK
C5R1 (C5AR1) (NM_001736) Human Mass Spec Standard
PH303784

USD 2,055.00

3 Weeks

C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727)

Tag C-Myc/DDK
Expression Host HEK293
C5R1 (C5AR1) ICC Control Block
TB403784

USD 1,070.00

4 Weeks

Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded controls for ICC/IHC staining

C5R1 (C5AR1) Cytosection
TS403784

USD 225.00

4 Weeks

Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

C5R1 (C5AR1) Cytosection
TS403784P5

USD 889.00

4 Weeks

Transient overexpression of C5AR1 (NM_001736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack