Germany
Japan
United Kingdom
China
USD 1,092.00
3 Weeks
Lenti ORF particles, IRAK3 (mGFP-tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Products
View as table Download
IRAK3 (Myc-DDK-tagged)-Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
IRAK3 (Myc-DDK-tagged)-Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
IRAK3 (GFP-tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Lenti ORF particles, IRAK3 (Myc-DDK tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF clone of Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IRAK3 (Myc-DDK tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 880.00
In Stock
Lenti ORF particles, IRAK3 (mGFP-tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 890.00
6 Weeks
Lenti ORF particles, IRAK3 (Myc-DDK tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 890.00
6 Weeks
Lenti ORF particles, IRAK3 (mGFP-tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IRAK3 (GFP-tagged) - Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IRAK3 (untagged)-Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IRAK3 (untagged)-Kinase deficient mutant (K192M) of Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-IRAK3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IRAK3 |
Rabbit Polyclonal Anti-IRAK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRAK3 antibody: synthetic peptide directed towards the C terminal of human IRAK3. Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL |
Rabbit Polyclonal Anti-IRAK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRAK3 Antibody: A synthesized peptide derived from human IRAK3 |
IRAK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IRAK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IRAK3 (untagged)-Human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti IRAK-M Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IRAK3 MS Standard C13 and N15-labeled recombinant protein (NP_009130)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of IRAK3 (NM_007199) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IRAK3 (NM_001142523) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IRAK3 (NM_007199) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IRAK3 (NM_007199) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IRAK3 (NM_001142523) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IRAK3 (NM_001142523) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IRAK3
Pathways
- Neurotrophin signaling pathway