PSENEN (Myc-DDK-tagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSENEN (Myc-DDK-tagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PSENEN (myc-DDK-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSENEN (GFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PEN2 (PSENEN) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | PSENEN antibody was raised against synthetic peptide - KLH conjugated |
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal PEN2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2. |
PSENEN HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal PEN2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2. |
Rabbit Polyclonal PSENEN/PEN2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human PEN2 (within residues 50-101). [UniProt# Q9NZ42] |
Rabbit Polyclonal Anti-PSENEN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT |
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PSENEN (GFP-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PSENEN (untagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSENEN (NM_172341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSENEN (NM_001281532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack