Germany
Japan
United Kingdom
China
POLR2H (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2H (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2H (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLR2H (myc-DDK-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (myc-DDK-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (myc-DDK-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (myc-DDK-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (myc-DDK-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-POLR2H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H. Synthetic peptide located within the following region: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
POLR2H (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
POLR2H HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal antibody to RPB8 (polymerase (RNA) II (DNA directed) polypeptide H)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of RPB8 (Uniprot ID#P52434) |
POLR2H / RPABC3 (1-150, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2H / RPABC3 (1-150, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI5A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI3C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2H (untagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2H (untagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2H (untagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2H (untagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2H (untagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2H mouse monoclonal antibody,clone OTI1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POLR2H mouse monoclonal antibody,clone OTI1H2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POLR2H mouse monoclonal antibody,clone OTI1H2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POLR2H mouse monoclonal antibody,clone OTI1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POLR2H mouse monoclonal antibody,clone OTI5A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POLR2H mouse monoclonal antibody,clone OTI5A1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POLR2H mouse monoclonal antibody,clone OTI5A1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POLR2H mouse monoclonal antibody,clone OTI5A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- POLR2H
Pathways
- Purine metabolism