Products

cDNA Clones (20)
Proteins (16)
Antibodies (4)
Jump to Filters
View as table Download
ACYP1 (NM_001107) Human Tagged ORF Clone
RC207110

USD 98.00

USD 390.00

In Stock

ACYP1 (Myc-DDK-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACYP1 (NM_001302616) Human Tagged ORF Clone
RC235589

USD 420.00

In Stock

ACYP1 (myc-DDK-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_001107) Human Tagged ORF Clone
RG207110

USD 460.00

In Stock

ACYP1 (GFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_001107) Human Tagged ORF Clone
RC207110L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_001107) Human Tagged ORF Clone Lentiviral Particle
RC207110L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACYP1 (Myc-DDK tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_001107) Human Tagged ORF Clone
RC207110L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_001107) Human Tagged ORF Clone Lentiviral Particle
RC207110L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACYP1 (mGFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_203488) Human Tagged ORF Clone
RC218256

USD 420.00

2 Weeks

ACYP1 (Myc-DDK-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_203488) Human Tagged ORF Clone
RC218256L3

USD 620.00

8 Weeks

Lenti-ORF clone of ACYP1 (Myc-DDK-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_203488) Human Tagged ORF Clone Lentiviral Particle
RC218256L3V

USD 820.00

11 Weeks

Lenti ORF particles, ACYP1 (Myc-DDK-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_203488) Human Tagged ORF Clone
RC218256L4

USD 620.00

8 Weeks

Lenti-ORF clone of ACYP1 (mGFP-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_203488) Human Tagged ORF Clone Lentiviral Particle
RC218256L4V

USD 820.00

11 Weeks

Lenti ORF particles, ACYP1 (mGFP-tagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACYP1 (NM_001302617) Human Tagged ORF Clone
RC235878

USD 420.00

2 Weeks

ACYP1 (myc-DDK-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_203488) Human Tagged ORF Clone
RG218256

USD 460.00

3 Weeks

ACYP1 (GFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 Rabbit Polyclonal Antibody
TA323229

USD 345.00

In Stock

Anti-ACYP1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-99 amino acids of human acylphosphatase 1, erythrocyte (common) type
ACYP1 (NM_001107) Human Over-expression Lysate
LC420125

USD 121.00

In Stock

ACYP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACYP1 (NM_001107) Human Untagged Clone
SC111924

USD 310.00

In Stock

ACYP1 (untagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACYP1 Goat Polyclonal Antibody
TA303184

USD 375.00

5 Days

Goat Polyclonal Antibody against ACYP1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKSHIDKANFNNEK, from the internal region of the protein sequence according to NP_001098.1.
ACYP1 (NM_001107) Human Over-expression Lysate
LY420125

USD 396.00

5 Days

Transient overexpression lysate of acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACYP1 Rabbit Polyclonal Antibody
TA334096

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACYP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK
Acylphosphatase 1 / ACYP1 (1-99, His-tag) Human Protein
AR09868PU-L

USD 845.00

2 Weeks

Acylphosphatase 1 / ACYP1 (1-99, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Acylphosphatase 1 / ACYP1 (1-99, His-tag) Human Protein
AR09868PU-N

USD 330.00

2 Weeks

Acylphosphatase 1 / ACYP1 (1-99, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ACYP1 (NM_001107) Human Mass Spec Standard
PH307110

USD 2,055.00

3 Weeks

ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098)

Tag C-Myc/DDK
Expression Host HEK293
ACYP1 (NM_001302616) Human Tagged ORF Clone
RG235589

USD 460.00

2 Weeks

ACYP1 (GFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_001302617) Human Tagged ORF Clone
RG235878

USD 460.00

2 Weeks

ACYP1 (GFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACYP1 (NM_203488) Human Untagged Clone
SC308210

USD 420.00

2 Weeks

ACYP1 (untagged)-Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ACYP1 (NM_001302616) Human Untagged Clone
SC333483

USD 310.00

2 Weeks

ACYP1 (untagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ACYP1 (NM_001302617) Human Untagged Clone
SC333772

USD 310.00

2 Weeks

ACYP1 (untagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ACYP1 Rabbit Polyclonal Antibody
TA323230

USD 345.00

In Stock

Anti-ACYP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-99 amino acids of human acylphosphatase 1, erythrocyte (common) type
ACYP1 (NM_001107) ICC Control Block
TB407110

USD 1,040.00

4 Weeks

Transient overexpression of ACYP1 (NM_001107) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACYP1 (NM_203488) ICC Control Block
TB418256

USD 1,070.00

4 Weeks

Transient overexpression of ACYP1 (NM_203488) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACYP1 (NM_001302616) ICC Control Block
TB435589

USD 1,070.00

4 Weeks

Transient overexpression of ACYP1 (NM_001302616) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACYP1 (NM_001302617) ICC Control Block
TB435878

USD 1,070.00

4 Weeks

Transient overexpression of ACYP1 (NM_001302617) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACYP1 Cytosection
TS407110

USD 225.00

4 Weeks

Transient overexpression of ACYP1 (NM_001107) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACYP1 Cytosection
TS407110P5

USD 889.00

4 Weeks

Transient overexpression of ACYP1 (NM_001107) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACYP1 ICC Control Sections
TS418256P5

USD 889.00

4 Weeks

Transient overexpression of ACYP1 (NM_203488) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACYP1 Cytosection
TS435589

USD 225.00

4 Weeks

Transient overexpression of ACYP1 (NM_001302616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACYP1 Cytosection
TS435589P5

USD 889.00

4 Weeks

Transient overexpression of ACYP1 (NM_001302616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACYP1 ICC Control Sections
TS435878P5

USD 889.00

4 Weeks

Transient overexpression of ACYP1 (NM_001302617) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack