Germany
Japan
United Kingdom
China
ABHD10 (Myc-DDK-tagged)-Human abhydrolase domain containing 10 (ABHD10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ABHD10 (Myc-DDK tagged) - Human abhydrolase domain containing 10 (ABHD10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABHD10 (mGFP-tagged) - Human abhydrolase domain containing 10 (ABHD10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human abhydrolase domain containing 10 (ABHD10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Abhd10 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 10 (Abhd10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD10 (GFP-tagged) - Human abhydrolase domain containing 10 (ABHD10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD10 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402393 is the updated version of KN202393.
Abhd10 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500646 is the updated version of KN300646.
Abhd10 (GFP-tagged) - Mouse abhydrolase domain containing 10 (Abhd10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abhd10 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 10 (Abhd10)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd10 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 10 (Abhd10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abhd10 (mGFP-tagged) - Mouse abhydrolase domain containing 10 (Abhd10)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd10 (GFP-tagged) - Mouse abhydrolase domain containing 10 (Abhd10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Abhd10 (myc-DDK-tagged) - Mouse abhydrolase domain containing 10 (Abhd10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human abhydrolase domain containing 10 (ABHD10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD10 (Myc-DDK tagged) - Human abhydrolase domain containing 10 (ABHD10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 10 (ABHD10), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD10 (mGFP-tagged) - Human abhydrolase domain containing 10 (ABHD10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABHD10 (Myc-DDK tagged) - Homo sapiens abhydrolase domain containing 10 (ABHD10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD10 (GFP-tagged) - Homo sapiens abhydrolase domain containing 10 (ABHD10), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abhd10 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abhd10 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd10 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abhd10 (mGFP-tagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd10 (GFP-tagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 10 (ABHD10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Abhd10 (untagged) - Mouse abhydrolase domain containing 10 (Abhd10), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human abhydrolase domain containing 10 (ABHD10), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Abhd10 (untagged ORF) - Rat abhydrolase domain containing 10 (Abhd10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABHD10 (untagged)-Human abhydrolase domain containing 10 (ABHD10)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABHD10 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of abhydrolase domain containing 10 (ABHD10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-ABHD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABHD10 antibody is: synthetic peptide directed towards the middle region of Human ABHD10. Synthetic peptide located within the following region: CIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGW |
ABHD10 (53-306, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
ABHD10 (53-306, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
ABHD10 CRISPRa kit - CRISPR gene activation of human abhydrolase domain containing 10
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abhd10 CRISPRa kit - CRISPR gene activation of mouse abhydrolase domain containing 10
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ABHD10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene ABHD10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ABHD10
ABHD10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Abhd10 (untagged) - Mouse abhydrolase domain containing 10 (Abhd10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Abhd10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Abhd10
ABHD10 MS Standard C13 and N15-labeled recombinant protein (NP_060864)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of abhydrolase domain containing 10 (ABHD10) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ABHD10 (untagged) - Homo sapiens abhydrolase domain containing 10 (ABHD10), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Abhd10 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Abhd10 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- ABHD10