Germany
Japan
United Kingdom
China
AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
AGER (untagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Ager (Myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ager (GFP-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ager (Myc-DDK-tagged ORF) - Rat advanced glycosylation end product-specific receptor (Ager), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ager - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500973 is the updated version of KN300973.
Lenti ORF clone of Ager (Myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ager (Myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ager (mGFP-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ager (GFP-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ager (myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ager (myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ager (myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ager (Myc-DDK-tagged ORF) - Rat advanced glycosylation end product-specific receptor (Ager), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ager (Myc-DDK-tagged ORF) - Rat advanced glycosylation end product-specific receptor (Ager), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ager (mGFP-tagged ORF) - Rat advanced glycosylation end product-specific receptor (Ager), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ager (GFP-tagged ORF) - Rat advanced glycosylation end product-specific receptor (Ager), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-AGER Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Ager (untagged) - Mouse advanced glycosylation end product-specific receptor (Ager), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG |
qSTAR qPCR primer pairs against Homo sapiens gene AGER
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
AGER (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319295 is the updated version of SR300125.
Rabbit anti-AGER Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AGER |
Active filters
Target Symbol
- AGER