Germany
Japan
United Kingdom
China
ALDH1B1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ALDH1B1 (GFP-tagged) - Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Aldh1b1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ALDH1B1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400684 is the updated version of KN200684.
Aldh1b1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501115 is the updated version of KN301115.
Aldh1b1 (GFP-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aldh1b1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh1b1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aldh1b1 (mGFP-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh1b1 (GFP-tagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALDH1B1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALDH1B1 (mGFP-tagged) - Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Aldh1b1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aldh1b1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh1b1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aldh1b1 (mGFP-tagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh1b1 (GFP-tagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALDH1B1 (untagged)-Human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ALDH1B1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
Aldh1b1 (untagged) - Mouse aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ALDH1B1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1. |
Rabbit Polyclonal Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALDH1B1 |
ALDH1B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
ALDH1B1 CRISPRa kit - CRISPR gene activation of human aldehyde dehydrogenase 1 family member B1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Aldh1b1 CRISPRa kit - CRISPR gene activation of mouse aldehyde dehydrogenase 1 family, member B1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ALDH1B1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ALDH1B1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Aldh1b1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Aldh1b1
ALDH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000683)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Aldh1b1 (untagged ORF) - Rat aldehyde dehydrogenase 1 family, member B1 (Aldh1b1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of aldehyde dehydrogenase 1 family member B1 (ALDH1B1) nuclear gene encoding mitochondrial protein for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ALDH1B1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Aldh1b1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Aldh1b1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ALDH1B1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ALDH1B1 |
ALDH1B1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1 |
ALDH1B1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 278-517 of human ALDH1B1 (NP_000683.3). |
| Modifications | Unmodified |
Transient overexpression of ALDH1B1 (NM_000692) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ALDH1B1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ALDH1B1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Aldh1b1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Aldh1b1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ALDH1B1
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Arginine and proline metabolism (18)
- Ascorbate and aldarate metabolism (18)
- Butanoate metabolism (18)
- Fatty acid metabolism (18)
- Glycerolipid metabolism (18)
- Glycolysis / Gluconeogenesis (18)
- Histidine metabolism (18)
- Limonene and pinene degradation (18)
- Lysine degradation (18)
- Metabolic pathways (18)
- Propanoate metabolism (18)
- Pyruvate metabolism (18)
- Tryptophan metabolism (18)
- Valine (18)
- beta-Alanine metabolism (18)
- leucine and isoleucine degradation (18)