Germany
Japan
United Kingdom
China
APRT (Myc-DDK-tagged)-Human adenine phosphoribosyltransferase (APRT), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
APRT (Myc-DDK-tagged)-Human adenine phosphoribosyltransferase (APRT), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
APRT (GFP-tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Aprt (Myc-DDK-tagged) - Mouse adenine phosphoribosyl transferase (Aprt)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
APRT - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN416874 is the updated version of KN216874.
Aprt - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501446 is the updated version of KN301446.
Aprt (GFP-tagged) - Mouse adenine phosphoribosyl transferase (Aprt)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aprt (Myc-DDK-tagged) - Mouse adenine phosphoribosyl transferase (Aprt)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aprt (Myc-DDK-tagged) - Mouse adenine phosphoribosyl transferase (Aprt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aprt (mGFP-tagged) - Mouse adenine phosphoribosyl transferase (Aprt)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aprt (GFP-tagged) - Mouse adenine phosphoribosyl transferase (Aprt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenine phosphoribosyltransferase (APRT), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, APRT (Myc-DDK tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenine phosphoribosyltransferase (APRT), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, APRT (mGFP-tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenine phosphoribosyltransferase (APRT), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, APRT (Myc-DDK tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenine phosphoribosyltransferase (APRT), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, APRT (mGFP-tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
APRT (GFP-tagged) - Human adenine phosphoribosyltransferase (APRT), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Aprt (Myc-DDK-tagged ORF) - Rat adenine phosphoribosyl transferase (Aprt), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aprt (Myc-DDK-tagged ORF) - Rat adenine phosphoribosyl transferase (Aprt), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aprt (Myc-DDK-tagged ORF) - Rat adenine phosphoribosyl transferase (Aprt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aprt (mGFP-tagged ORF) - Rat adenine phosphoribosyl transferase (Aprt), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aprt (GFP-tagged ORF) - Rat adenine phosphoribosyl transferase (Aprt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
APRT - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Aprt (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal APRT Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-40 amino acids from the N-terminal region of human APRT. |
Rabbit anti-APRT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APRT |
Rabbit Polyclonal Anti-APRT Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APRT antibody: synthetic peptide directed towards the N terminal of human APRT. Synthetic peptide located within the following region: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK |
APRT (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
APRT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
APRT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
APRT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Aprt (untagged) - Mouse adenine phosphoribosyl transferase (Aprt), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
APRT (untagged)-Human adenine phosphoribosyltransferase (APRT), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal APRT Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-170 amino acids from the C-terminal region of human APRT. |
APRT (1-180) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
APRT (1-180) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
APRT CRISPRa kit - CRISPR gene activation of human adenine phosphoribosyltransferase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Aprt CRISPRa kit - CRISPR gene activation of mouse adenine phosphoribosyl transferase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene APRT
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene APRT
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422236 is the same product as LY425509.
Transient overexpression lysate of adenine phosphoribosyltransferase (APRT), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Aprt
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Aprt
APRT MS Standard C13 and N15-labeled recombinant protein (NP_000476)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, APRT (Myc-DDK-tagged)-Human adenine phosphoribosyltransferase (APRT), transcript variant 2, 250ul, >10^13 TU/mL
- AAV ORF®
-
Active filters
Target Symbol
- APRT