Products

cDNA Clones (31)
Proteins (14)
RNAi (12)
Gene Expression (9)
Antibodies (8)
Jump to Filters
View as table Download
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA332918

USD 275.00

3 Weeks

Rabbit anti-ATP1B1 Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP1B1
Atp1b1 (NM_009721) Mouse Tagged ORF Clone
MR204262

USD 68.00

USD 219.00

In Stock

Atp1b1 (Myc-DDK-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Tagged ORF Clone Lentiviral Particle
RC200500L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, ATP1B1 (Myc-DDK tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Tagged ORF Clone Lentiviral Particle
RC200500L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, ATP1B1 (mGFP-tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Tagged ORF Clone Lentiviral Particle
RC200500L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, ATP1B1 (mGFP-tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 Mouse Gene Knockout Kit (CRISPR)
KN501772

USD 1,290.00

2 Weeks

Atp1b1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501772 is the updated version of KN301772.
Atp1b1 (BC027319) Mouse Tagged ORF Clone
MG204262

USD 300.00

3 Weeks

Atp1b1 (GFP-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (cDNA clone MGC:6286 IMAGE:2648940)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp1b1 (NM_009721) Mouse Tagged ORF Clone
MR204262L3

USD 500.00

3 Weeks

Lenti ORF clone of Atp1b1 (Myc-DDK-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_009721) Mouse Tagged ORF Clone Lentiviral Particle
MR204262L3V

USD 700.00

6 Weeks

Lenti ORF particles, Atp1b1 (Myc-DDK-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_009721) Mouse Tagged ORF Clone
MR204262L4

USD 500.00

3 Weeks

Lenti ORF clone of Atp1b1 (mGFP-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_009721) Mouse Tagged ORF Clone Lentiviral Particle
MR204262L4V

USD 700.00

6 Weeks

Lenti ORF particles, Atp1b1 (GFP-tagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Tagged ORF Clone Lentiviral Particle
RC200500L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, ATP1B1 (Myc-DDK tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Tagged ORF Clone
RC219880L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Tagged ORF Clone Lentiviral Particle
RC219880L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP1B1 (Myc-DDK tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Tagged ORF Clone Lentiviral Particle
RC219880L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP1B1 (mGFP-tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_013113) Rat Tagged ORF Clone
RR211819

USD 420.00

4 Weeks

Atp1b1 (Myc-DDK-tagged ORF) - Rat ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp1b1 (NM_013113) Rat Tagged ORF Clone
RR211819L3

USD 640.00

8 Weeks

Lenti ORF clone of Atp1b1 (Myc-DDK-tagged ORF) - Rat ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_013113) Rat Tagged ORF Clone Lentiviral Particle
RR211819L3V

USD 850.00

12 Weeks

Lenti ORF particles, Atp1b1 (Myc-DDK-tagged ORF) - Rat ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_013113) Rat Tagged ORF Clone
RR211819L4

USD 700.00

8 Weeks

Lenti ORF clone of Atp1b1 (mGFP-tagged ORF) - Rat ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_013113) Rat Tagged ORF Clone Lentiviral Particle
RR211819L4V

USD 960.00

12 Weeks

Lenti ORF particles, Atp1b1 (GFP-tagged ORF) - Rat ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp1b1 (NM_009721) Mouse Untagged Clone
MC202830

USD 210.00

In Stock

Atp1b1 (untagged) - Mouse ATPase, Na+/K+ transporting, beta 1 polypeptide (Atp1b1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Over-expression Lysate
LY400361

USD 396.00

In Stock

Transient overexpression lysate of ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
beta 1 Sodium Potassium ATPase (ATP1B1) Mouse Monoclonal Antibody [Clone ID: 464.8 (also known as 8A)]
TA309581

USD 424.00

In Stock

Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))

Applications WB
Reactivities Bovine, Canine, Human, Porcine, Rabbit, Rat
Conjugation Unconjugated
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Over-expression Lysate
LY419810

USD 396.00

In Stock

Transient overexpression lysate of ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY419810 is the same product as LY429076.
ATP1B1 Human siRNA Oligo Duplex (Locus ID 481)
SR300339

USD 430.00

In Stock

ATP1B1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Atp1b1 Goat Polyclonal Antibody
TA311213

USD 375.00

5 Days

Goat Anti-ATP1B1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTEISFRPNDPKSYE, from the internal region of the protein sequence according to NP_001668.1; NP_001001787.1.
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA335283

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the N terminal of human ATP1B1. Synthetic peptide located within the following region: RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA335284

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP1B1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
ATP1B1 Human shRNA Plasmid Kit (Locus ID 481)
TR314599

USD 715.00

2 Weeks

ATP1B1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
ATP1B1 (63-303, His-tag) Human Protein
AR51103PU-N

USD 845.00

2 Weeks

ATP1B1 (63-303, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ATP1B1 (63-303, His-tag) Human Protein
AR51103PU-S

USD 330.00

2 Weeks

ATP1B1 (63-303, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human beta 1 Sodium Potassium ATPase (ATP1B1) activation kit by CRISPRa
GA100338

USD 1,290.00

2 Weeks

ATP1B1 CRISPRa kit - CRISPR gene activation of human ATPase Na+/K+ transporting subunit beta 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Atp1b1 activation kit by CRISPRa
GA200316

USD 1,290.00

2 Weeks

Atp1b1 CRISPRa kit - CRISPR gene activation of mouse ATPase, Na+/K+ transporting, beta 1 polypeptide

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
beta 1 Sodium Potassium ATPase (ATP1B1) Human qPCR Primer Pair (NM_001677)
HP226818

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ATP1B1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)