Products

cDNA Clones (43)
Proteins (18)
Antibodies (6)
Gene Expression (4)
RNAi (3)
Jump to Filters
View as table Download
CARD8 (NM_001184900) Human Tagged ORF Clone
RC230245

USD 480.00

In Stock

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CARD8 (NM_001184904) Human Tagged ORF Clone
RC229496

USD 420.00

In Stock

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_014959) Human Tagged ORF Clone
RG211512

USD 460.00

In Stock

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184903) Human Tagged ORF Clone
RG229986

USD 460.00

In Stock

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 Human Gene Knockout Kit (CRISPR)
KN411512

USD 1,290.00

2 Weeks

CARD8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN411512 is the updated version of KN211512.
CARD8 (NM_014959) Human Tagged ORF Clone
RC211512

USD 420.00

2 Weeks

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_014959) Human Tagged ORF Clone
RC211512L3

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_014959) Human Tagged ORF Clone Lentiviral Particle
RC211512L3V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_014959) Human Tagged ORF Clone
RC211512L4

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_014959) Human Tagged ORF Clone Lentiviral Particle
RC211512L4V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184904) Human Tagged ORF Clone
RC229496L3

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184904) Human Tagged ORF Clone Lentiviral Particle
RC229496L3V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184904) Human Tagged ORF Clone
RC229496L4

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184904) Human Tagged ORF Clone Lentiviral Particle
RC229496L4V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184902) Human Tagged ORF Clone
RC229985

USD 420.00

3 Weeks

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184902) Human Tagged ORF Clone
RC229985L3

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184902) Human Tagged ORF Clone Lentiviral Particle
RC229985L3V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184902) Human Tagged ORF Clone
RC229985L4

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184902) Human Tagged ORF Clone Lentiviral Particle
RC229985L4V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184903) Human Tagged ORF Clone
RC229986

USD 420.00

3 Weeks

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184903) Human Tagged ORF Clone
RC229986L3

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184903) Human Tagged ORF Clone Lentiviral Particle
RC229986L3V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184903) Human Tagged ORF Clone
RC229986L4

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184903) Human Tagged ORF Clone Lentiviral Particle
RC229986L4V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184901) Human Tagged ORF Clone
RC230166

USD 420.00

3 Weeks

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184901) Human Tagged ORF Clone
RC230166L3

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184901) Human Tagged ORF Clone Lentiviral Particle
RC230166L3V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184901) Human Tagged ORF Clone
RC230166L4

USD 620.00

3 Weeks

Lenti-ORF clone of CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184901) Human Tagged ORF Clone Lentiviral Particle
RC230166L4V

USD 820.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184900) Human Tagged ORF Clone
RC230245L3

USD 680.00

3 Weeks

Lenti ORF clone of Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184900) Human Tagged ORF Clone Lentiviral Particle
RC230245L3V

USD 880.00

6 Weeks

Lenti ORF particles, CARD8 (Myc-DDK tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184900) Human Tagged ORF Clone
RC230245L4

USD 680.00

3 Weeks

Lenti ORF clone of Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184900) Human Tagged ORF Clone Lentiviral Particle
RC230245L4V

USD 880.00

6 Weeks

Lenti ORF particles, CARD8 (mGFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CARD8 (NM_001184904) Human Tagged ORF Clone
RG229496

USD 460.00

3 Weeks

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184902) Human Tagged ORF Clone
RG229985

USD 460.00

4 Weeks

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184901) Human Tagged ORF Clone
RG230166

USD 460.00

4 Weeks

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 (NM_001184900) Human Tagged ORF Clone
RG230245

USD 530.00

3 Weeks

CARD8 (GFP-tagged) - Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CARD8 Rabbit Polyclonal Antibody
TA306138

USD 430.00

In Stock

Rabbit Polyclonal CARD8 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CARD8 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARD8.
CARD8 (NM_001184900) Human Untagged Clone
SC328883

USD 910.00

In Stock

CARD8 (untagged)-Human caspase recruitment domain family member 8 (CARD8) transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CARD8 Rabbit Polyclonal Antibody
TA326822

USD 275.00

3 Weeks

CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CARD8
CARD8 (NM_001184904) Human Untagged Clone
SC328134

USD 420.00

In Stock

CARD8 (untagged)-Human caspase recruitment domain family member 8 (CARD8) transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CARD8 (NM_001184900) Human Over-expression Lysate
LC433245

USD 121.00

In Stock

CARD8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CARD8 (NM_001184900) Human Over-expression Lysate
LY433245

USD 396.00

5 Days

Transient overexpression lysate of caspase recruitment domain family, member 8 (CARD8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CARD8 (NM_014959) Human Untagged Clone
SC114692

USD 760.00

2 Weeks

CARD8 (untagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CARD8 Rabbit Polyclonal Antibody
TA324044

USD 345.00

4 Weeks

Anti-CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 200 amino acids of human Caspase recruitment domain-containing protein 8
CARD8 Rabbit Polyclonal Antibody
TA334072

USD 375.00

5 Days

Rabbit Polyclonal Anti-CARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID
Human CARD8 activation kit by CRISPRa
GA107895

USD 1,290.00

2 Weeks

CARD8 CRISPRa kit - CRISPR gene activation of human caspase recruitment domain family member 8

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CARD8 Human qPCR Template Standard (NM_014959)
HK210285

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CARD8

Application Plasmid of exact quantity for transcript copy number calculation
CARD8 Human qPCR Primer Pair (NM_014959)
HP211287

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CARD8

Human CARD8 (NM_001184904) AAV Particle
RC229496A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 6, 250ul, >10^13 TU/mL

  • AAV ORF®