Products

cDNA Clones (29)
Proteins (16)
Antibodies (13)
RNAi (12)
Gene Expression (6)
Assay Kits (1)
Jump to Filters
View as table Download
Properdin (CFP) (NM_002621) Human Tagged ORF Clone
RC204890

USD 420.00

In Stock

CFP (Myc-DDK-tagged)-Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Properdin (CFP) (NM_001145252) Human Tagged ORF Clone
RC227711

USD 420.00

In Stock

CFP (Myc-DDK-tagged)-Human complement factor properdin (CFP), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cfp (NM_008823) Mouse Tagged ORF Clone
MR220985

USD 350.00

In Stock

Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Properdin (CFP) (NM_002621) Human Tagged ORF Clone
RG204890

USD 460.00

In Stock

CFP (GFP-tagged) - Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cfp Mouse Gene Knockout Kit (CRISPR)
KN503219

USD 1,290.00

2 Weeks

Cfp - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503219 is the updated version of KN303219.
Cfp (NM_008823) Mouse Tagged ORF Clone
MG220985

USD 390.00

3 Weeks

Cfp (GFP-tagged) - Mouse complement factor properdin (Cfp), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cfp (NM_008823) Mouse Tagged ORF Clone
MR220985L3

USD 550.00

3 Weeks

Lenti ORF clone of Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_008823) Mouse Tagged ORF Clone Lentiviral Particle
MR220985L3V

USD 750.00

6 Weeks

Lenti ORF particles, Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_008823) Mouse Tagged ORF Clone
MR220985L4

USD 550.00

3 Weeks

Lenti ORF clone of Cfp (mGFP-tagged) - Mouse complement factor properdin (Cfp)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_008823) Mouse Tagged ORF Clone Lentiviral Particle
MR220985L4V

USD 750.00

6 Weeks

Lenti ORF particles, Cfp (GFP-tagged) - Mouse complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_002621) Human Tagged ORF Clone
RC204890L3

USD 620.00

3 Weeks

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_002621) Human Tagged ORF Clone Lentiviral Particle
RC204890L3V

USD 820.00

6 Weeks

Lenti ORF particles, CFP (Myc-DDK tagged) - Human complement factor properdin (CFP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_002621) Human Tagged ORF Clone
RC204890L4

USD 620.00

3 Weeks

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_001145252) Human Tagged ORF Clone
RC227711L3

USD 620.00

3 Weeks

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_001145252) Human Tagged ORF Clone Lentiviral Particle
RC227711L3V

USD 820.00

6 Weeks

Lenti ORF particles, CFP (Myc-DDK tagged) - Human complement factor properdin (CFP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_001145252) Human Tagged ORF Clone
RC227711L4

USD 620.00

3 Weeks

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) (NM_001145252) Human Tagged ORF Clone
RG227711

USD 460.00

3 Weeks

CFP (GFP-tagged) - Human complement factor properdin (CFP), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cfp (NM_001106757) Rat Tagged ORF Clone
RR203422

USD 640.00

4 Weeks

Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cfp (NM_001106757) Rat Tagged ORF Clone
RR203422L3

USD 830.00

9 Weeks

Lenti ORF clone of Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_001106757) Rat Tagged ORF Clone Lentiviral Particle
RR203422L3V

USD 1,050.00

13 Weeks

Lenti ORF particles, Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_001106757) Rat Tagged ORF Clone
RR203422L4

USD 910.00

9 Weeks

Lenti ORF clone of Cfp (mGFP-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cfp (NM_001106757) Rat Tagged ORF Clone Lentiviral Particle
RR203422L4V

USD 1,170.00

13 Weeks

Lenti ORF particles, Cfp (GFP-tagged ORF) - Rat complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Properdin (CFP) Rabbit Polyclonal Antibody
TA332666

USD 275.00

2 Weeks

Rabbit anti-CFP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CFP
Properdin (CFP) Goat Polyclonal Antibody
AP21474SU-N

USD 270.00

2 Weeks

Properdin (CFP) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Properdin (CFP) (NM_002621) Human Untagged Clone
SC319542

USD 310.00

In Stock

CFP (untagged)-Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Properdin (CFP) Goat Polyclonal Antibody
AP21474FC-N

USD 410.00

2 Weeks

Properdin (CFP) goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Properdin (CFP) Mouse Monoclonal Antibody [Clone ID: 10-18]
AM01337PU-N

USD 590.00

5 Days

Properdin (CFP) mouse monoclonal antibody, clone 10-18, Purified

Applications ELISA, FN, IHC
Reactivities Human
Properdin (CFP) Mouse Monoclonal Antibody [Clone ID: 10-24]
AM01338PU-N

USD 600.00

5 Days

Properdin (CFP) mouse monoclonal antibody, clone 10-24, Purified

Applications ELISA, IHC
Reactivities Human
Properdin (CFP) Mouse Monoclonal Antibody [Clone ID: KT20]
AM20806PU-L

USD 1,280.00

2 Weeks

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human
Properdin (CFP) (Center) Rabbit Polyclonal Antibody
AP50880PU-N

USD 450.00

2 Weeks

Properdin (CFP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203~233 amino acids from the Central region of human CFP
Properdin (CFP) (NM_002621) Human Over-expression Lysate
LY400935

USD 396.00

5 Days

Transient overexpression lysate of complement factor properdin (CFP), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Properdin (CFP) Rabbit Polyclonal Antibody
TA337677

USD 375.00

5 Days

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the N terminal of human CFP. Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
Properdin (CFP) Mouse Monoclonal Antibody [Clone ID: KT20]
AM20806PU-N

USD 560.00

2 Weeks

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human
Properdin (CFP) Mouse Monoclonal Antibody [Clone ID: KT20]
AM20806PU-S

USD 405.00

2 Weeks

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human
Properdin (CFP) Rabbit Polyclonal Antibody
TA337678

USD 375.00

5 Days

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the middle region of human CFP. Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
Properdistatin Human Protein
AR31132PU-L

USD 570.00

5 Days

Properdistatin protein, 5.0 mg

Properdistatin Human Protein
AR31132PU-N

USD 240.00

5 Days

Properdistatin protein, 1.0 mg

Properdistatin Human Protein
AR31132PU-S

USD 180.00

5 Days

Properdistatin protein, 0.5 mg

Properdistatin Human Protein
AR31132PU-T

USD 105.00

5 Days

Properdistatin protein, 0.1 mg

Properdin (28-469, His-tag) Human Protein
AR51565PU-N

USD 845.00

2 Weeks

Properdin (28-469, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Properdin (28-469, His-tag) Human Protein
AR51565PU-S

USD 330.00

2 Weeks

Properdin (28-469, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human Properdin (CFP) ELISA KIT (1 x 96 wells)
EA102466

USD 470.00

3 Weeks

For Quantitative Detection of human Properdin in cell culture supernates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Properdin
Format 8x12 divisible strips
Reactivities Human
Human Properdin (CFP) activation kit by CRISPRa
GA103491

USD 1,290.00

2 Weeks

CFP CRISPRa kit - CRISPR gene activation of human complement factor properdin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Cfp activation kit by CRISPRa
GA203184

USD 1,290.00

2 Weeks

Cfp CRISPRa kit - CRISPR gene activation of mouse complement factor properdin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Properdin (CFP) Human qPCR Template Standard (NM_002621)
HK201935

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CFP

Application Plasmid of exact quantity for transcript copy number calculation
Properdin (CFP) Human qPCR Primer Pair (NM_002621)
HP206276

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CFP

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Properdin (CFP) (NM_002621) Human Over-expression Lysate
LC400935

USD 121.00

2 Weeks

CFP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Properdin (CFP) (NM_001145252) Human Over-expression Lysate
LC428763

USD 121.00

2 Weeks

CFP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB