Products

View as table Download

CFP (Myc-DDK-tagged)-Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CFP (Myc-DDK-tagged)-Human complement factor properdin (CFP), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CFP (GFP-tagged) - Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cfp - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503219 is the updated version of KN303219.

Cfp (GFP-tagged) - Mouse complement factor properdin (Cfp), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cfp (Myc-DDK-tagged) - Mouse complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cfp (mGFP-tagged) - Mouse complement factor properdin (Cfp)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cfp (GFP-tagged) - Mouse complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CFP (Myc-DDK tagged) - Human complement factor properdin (CFP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CFP (Myc-DDK tagged) - Human complement factor properdin (CFP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human complement factor properdin (CFP), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CFP (GFP-tagged) - Human complement factor properdin (CFP), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cfp (Myc-DDK-tagged ORF) - Rat complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cfp (mGFP-tagged ORF) - Rat complement factor properdin (Cfp), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cfp (GFP-tagged ORF) - Rat complement factor properdin (Cfp), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-CFP Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CFP

Properdin (CFP) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

CFP (untagged)-Human complement factor properdin (CFP), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Properdin (CFP) goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Properdin (CFP) mouse monoclonal antibody, clone 10-18, Purified

Applications ELISA, FN, IHC
Reactivities Human

Properdin (CFP) mouse monoclonal antibody, clone 10-24, Purified

Applications ELISA, IHC
Reactivities Human

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human

Properdin (CFP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 203~233 amino acids from the Central region of human CFP

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the N terminal of human CFP. Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human

Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified

Applications ELISA
Reactivities Human

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the middle region of human CFP. Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE

Properdistatin protein, 5.0 mg

Properdistatin protein, 1.0 mg

Properdistatin protein, 0.5 mg

Properdistatin protein, 0.1 mg

Properdin (28-469, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Properdin (28-469, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

For Quantitative Detection of human Properdin in cell culture supernates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Properdin
Format 8x12 divisible strips
Reactivities Human

CFP CRISPRa kit - CRISPR gene activation of human complement factor properdin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cfp CRISPRa kit - CRISPR gene activation of mouse complement factor properdin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CFP

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene CFP

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

CFP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

CFP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB