Germany
Japan
United Kingdom
China
DUSP11 (Myc-DDK-tagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, DUSP11 (Myc-DDK tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DUSP11 (mGFP-tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Dusp11 (Myc-DDK-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP11 (GFP-tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP11 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401822 is the updated version of KN201822.
Dusp11 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504864 is the updated version of KN304864.
Dusp11 (GFP-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dusp11 (Myc-DDK-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dusp11 (Myc-DDK-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dusp11 (mGFP-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dusp11 (GFP-tagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP11 (Myc-DDK tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP11 (mGFP-tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Dusp11 (Myc-DDK-tagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dusp11 (Myc-DDK-tagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dusp11 (Myc-DDK-tagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dusp11 (mGFP-tagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dusp11 (GFP-tagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-Dusp11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dusp11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII |
Rabbit Polyclonal Anti-Dusp11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dusp11 antibody is: synthetic peptide directed towards the middle region of Mouse Dusp11. Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK |
Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
DUSP11 (untagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
DUSP11 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
DUSP11 CRISPRa kit - CRISPR gene activation of human dual specificity phosphatase 11
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dusp11 CRISPRa kit - CRISPR gene activation of mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DUSP11
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DUSP11
DUSP11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Dusp11 (untagged) - Mouse dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dusp11
Dusp11 (untagged ORF) - Rat dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (Dusp11), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
DUSP11 (untagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DUSP11 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Dusp11 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Dusp11 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DUSP11 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DUSP11 |
Transient overexpression of DUSP11 (NM_003584) in HEK293T cells paraffin embedded controls for ICC/IHC staining
DUSP11 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
DUSP11 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Dusp11 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Dusp11 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- DUSP11