Products

cDNA Clones (38)
RNAi (12)
Proteins (10)
Antibodies (8)
Gene Expression (6)
Jump to Filters
View as table Download
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone
RG210390

USD 460.00

In Stock

GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glra1 (NM_020492) Mouse Tagged ORF Clone
MG222118

USD 520.00

In Stock

Glra1 (GFP-tagged) - Mouse glycine receptor alpha 1 subunit (Glra1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glra1 (NM_020492) Mouse Tagged ORF Clone
MR222118

USD 470.00

In Stock

Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Glra1 Mouse Gene Knockout Kit (CRISPR)
KN506530

USD 1,290.00

2 Weeks

Glra1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506530 is the updated version of KN306530.
Glra1 (NM_020492) Mouse Tagged ORF Clone
MR222118L3

USD 670.00

3 Weeks

Lenti ORF clone of Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_020492) Mouse Tagged ORF Clone Lentiviral Particle
MR222118L3V

USD 870.00

6 Weeks

Lenti ORF particles, Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_020492) Mouse Tagged ORF Clone
MR222118L4

USD 670.00

3 Weeks

Lenti ORF clone of Glra1 (mGFP-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_020492) Mouse Tagged ORF Clone Lentiviral Particle
MR222118L4V

USD 870.00

6 Weeks

Lenti ORF particles, Glra1 (GFP-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_001290821) Mouse Tagged ORF Clone
MR230006

USD 480.00

2 Weeks

Glra1 (myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone Lentiviral Particle
RC210390L3V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (Myc-DDK tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Tagged ORF Clone Lentiviral Particle
RC210390L4V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (mGFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_001146040) Human Tagged ORF Clone Lentiviral Particle
RC228907L3V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_001146040) Human Tagged ORF Clone Lentiviral Particle
RC228907L4V

USD 820.00

6 Weeks

Lenti ORF particles, GLRA1 (mGFP-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_013133) Rat Tagged ORF Clone
RR210096

USD 610.00

4 Weeks

Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Glra1 (NM_013133) Rat Tagged ORF Clone
RR210096L3

USD 810.00

8 Weeks

Lenti ORF clone of Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_013133) Rat Tagged ORF Clone Lentiviral Particle
RR210096L3V

USD 1,030.00

12 Weeks

Lenti ORF particles, Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_013133) Rat Tagged ORF Clone
RR210096L4

USD 890.00

8 Weeks

Lenti ORF clone of Glra1 (mGFP-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glra1 (NM_013133) Rat Tagged ORF Clone Lentiviral Particle
RR210096L4V

USD 1,140.00

12 Weeks

Lenti ORF particles, Glra1 (GFP-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Untagged Clone
SC310373

USD 760.00

In Stock

GLRA1 (untagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC310373 is the updated version of SC123992.
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA327455

USD 275.00

3 Weeks

Rabbit anti-GLRA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GLRA1
Glra1 (NM_013133) Rat Untagged Clone
RN210096

USD 610.00

In Stock

Glra1 (untagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Glra1 Mouse shRNA Plasmid (Locus ID 14654)
TL500822

USD 815.00

In Stock

Glra1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Glra1 Rabbit Polyclonal Antibody
TA328847

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Glycine Receptor Alpha1

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RHHKSPMLNLFQD, corresponding to amino acid residues 350-362 of rat GlyRa1. 2nd intracellular loop.
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
LY400062

USD 396.00

5 Days

Transient overexpression lysate of glycine receptor, alpha 1 (GLRA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Glra1 Rabbit Polyclonal Antibody
TA309158

USD 415.00

5 Days

Rabbit Anti-Glycine Receptor Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH
alpha 1 Glycine Receptor (GLRA1) Rabbit Polyclonal Antibody
TA330417

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLRA1 antibody: synthetic peptide directed towards the middle region of human GLRA1. Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE
Human alpha 1 Glycine Receptor (GLRA1) activation kit by CRISPRa
GA101828

USD 1,290.00

2 Weeks

GLRA1 CRISPRa kit - CRISPR gene activation of human glycine receptor alpha 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Glra1 activation kit by CRISPRa
GA201635

USD 1,290.00

2 Weeks

Glra1 CRISPRa kit - CRISPR gene activation of mouse glycine receptor, alpha 1 subunit

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
alpha 1 Glycine Receptor (GLRA1) Human qPCR Template Standard (NM_000171)
HK203374

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GLRA1

Application Plasmid of exact quantity for transcript copy number calculation
alpha 1 Glycine Receptor (GLRA1) Human qPCR Primer Pair (NM_000171)
HP200156

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GLRA1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Glra1 (NM_020492) Mouse Untagged Clone
MC215940

USD 610.00

4 Weeks

Glra1 (untagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Glra1 (NM_001290821) Mouse Untagged Clone
MC227795

USD 460.00

2 Weeks

Glra1 (untagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Glra1 Mouse qPCR Primer Pair (NM_020492)
MP205628

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Glra1

alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human 3' UTR Clone
SC201810

USD 560.00

4 Weeks

3`UTR clone of glycine receptor alpha 1 (GLRA1) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
alpha 1 Glycine Receptor (GLRA1) (NM_001146040) Human 3' UTR Clone
SC201811

USD 560.00

4 Weeks

3`UTR clone of glycine receptor alpha 1 (GLRA1) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase