GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Glra1 (GFP-tagged) - Mouse glycine receptor alpha 1 subunit (Glra1), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GLRA1 (Myc-DDK tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GLRA1 (mGFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Glra1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Glra1 (Myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Glra1 (mGFP-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Glra1 (GFP-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Glra1 (myc-DDK-tagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GLRA1 (Myc-DDK tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GLRA1 (mGFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti-ORF clone of GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GLRA1 (Myc-DDK-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti-ORF clone of GLRA1 (mGFP-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GLRA1 (mGFP-tagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GLRA1 (myc-DDK-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Glra1 (Myc-DDK-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Glra1 (mGFP-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Glra1 (GFP-tagged ORF) - Rat glycine receptor, alpha 1 (Glra1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GLRA1 (untagged)-Human glycine receptor alpha 1 (GLRA1) transcript variant 1
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GLRA1 (untagged)-Human glycine receptor, alpha 1 (GLRA1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit anti-GLRA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GLRA1 |
Lenti ORF clone of Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glycine receptor, alpha 1 (GLRA1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Glra1 (untagged ORF) - Rat glycine receptor, alpha 1 (Glra1), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Glra1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
USD 121.00
In Stock
GLRA1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-Glycine Receptor Alpha1
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RHHKSPMLNLFQD, corresponding to amino acid residues 350-362 of rat GlyRa1. 2nd intracellular loop. |
USD 396.00
5 Days
Transient overexpression lysate of glycine receptor, alpha 1 (GLRA1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Anti-Glycine Receptor Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal Anti-GLRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLRA1 antibody: synthetic peptide directed towards the middle region of human GLRA1. Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE |
GLRA1 CRISPRa kit - CRISPR gene activation of human glycine receptor alpha 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Glra1 CRISPRa kit - CRISPR gene activation of mouse glycine receptor, alpha 1 subunit
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
USD 330.00
5 Days
qPCR primer pairs and template standards against Homo sapiens gene GLRA1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GLRA1
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Glra1 (untagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Glra1 (untagged) - Mouse glycine receptor, alpha 1 subunit (Glra1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Glra1
GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
3`UTR clone of glycine receptor alpha 1 (GLRA1) transcript variant 2 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of glycine receptor alpha 1 (GLRA1) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |