Germany
Japan
United Kingdom
China
GNA15 (untagged)-Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadGNA15 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Gna15 (untagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gna15 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, GNA15 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, GNA15 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GNA15 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gna15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507061 is the updated version of KN307061.
Gna15 (GFP-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gna15 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gna15 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gna15 (mGFP-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gna15 (GFP-tagged) - Mouse guanine nucleotide binding protein, alpha 15 (Gna15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
In Stock
Lenti ORF particles, GNA15 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, GNA15 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Gna15 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gna15 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gna15 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gna15 (mGFP-tagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gna15 (GFP-tagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal anti-Ga15/16 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 356of human G 15 |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG |
Gna15 (untagged ORF) - Rat guanine nucleotide binding protein, alpha 15 (Gna15), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
G protein alpha 16 (GNA15) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 340-369 amino acids from the C-terminal region of human G protein alpha 15 |
GNA15 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Human guanine nucleotide binding protein (G protein), alpha 15 (Gq class) (GNA15), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
GNA15 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Gna15 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody,clone OTI1D3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GNA15 CRISPRa kit - CRISPR gene activation of human G protein subunit alpha 15
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GNA15
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GNA15
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Gna15
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Gna15
3`UTR clone of guanine nucleotide binding protein (G protein) alpha 15 (Gq class) (GNA15) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Gna15 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GNA15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3). |
USD 379.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
USD 159.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
GNA15 mouse monoclonal antibody,clone OTI1D3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody,clone OTI1D3, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody,clone OTI1D3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- GNA15