Germany
Japan
United Kingdom
China
Lenti ORF particles, GRK5 (mGFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table Download
GRK5 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GRK5 (untagged)-Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human G protein-coupled receptor kinase 5 (GRK5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, GRK5 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GRK5 (mGFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GRK5 (GFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Grk5 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 5 (Grk5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409137 is the updated version of KN209137.
Lenti ORF clone of Grk5 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 5 (Grk5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Grk5 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 5 (Grk5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Grk5 (mGFP-tagged) - Mouse G protein-coupled receptor kinase 5 (Grk5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Grk5 (GFP-tagged) - Mouse G protein-coupled receptor kinase 5 (Grk5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK5 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GRK5 Mutant (Q41L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 5 (GRK5) as transfection-ready DNA
| Mutation | Q41L |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Grk5 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Grk5 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Grk5 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Grk5 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Grk5 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GRK5 (untagged)-Kinase deficient mutant (K215M) of Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GRK5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Grk5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-GRK5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK5. |
GRK5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal GRK5 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GRK5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 559-590 amino acids from the C-terminal region of human GRK5. |
GRK5 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
GRK5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Transient overexpression lysate of G protein-coupled receptor kinase 5 (GRK5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon (100%); Marmoset, Mouse, Rat, Panda, Dog, Bat, Horse (93%); Elephant, Bovine, Pig (87%). |
GRK5 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human |
| Immunogen | GRK5 antibody was raised against synthetic 12 amino acid peptide from near N-terminus of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Dog, Bovine (100%); Mouse, Rat, Pig (92%); Opossum, Chicken (83%). |
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Horse, Human, Monkey, Mouse, Pig, Rat |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Panda, Horse, Pig, Opossum, Turkey, Chicken, Platypus (100%); Orangutan, Dog, Elephant, Xenopus (93%). |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK5. Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS |
GRK5 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Grk5 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GRK5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GRK5
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
GRK5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
GRK5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
GRK5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
qSTAR qPCR primer pairs against Mus musculus gene Grk5
GRK5 MS Standard C13 and N15-labeled recombinant protein (NP_005299)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Grk5 (untagged ORF) - Rat G protein-coupled receptor kinase 5 (Grk5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of G protein-coupled receptor kinase 5 (GRK5) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Grk5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- GRK5