Germany
Japan
United Kingdom
China
ISG15 (Myc-DDK-tagged)-Human ISG15 ubiquitin-like modifier (ISG15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Recombinant protein of human ISG15 ubiquitin-like modifier (ISG15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Isg15 (Myc-DDK-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ISG15 (Myc-DDK tagged) - Human ISG15 ubiquitin-like modifier (ISG15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ISG15 (mGFP-tagged) - Human ISG15 ubiquitin-like modifier (ISG15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ISG15 (GFP-tagged) - Human ISG15 ubiquitin-like modifier (ISG15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ISG15 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401235 is the updated version of KN201235.
Isg15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508450 is the updated version of KN308450.
Isg15 (GFP-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Isg15 (Myc-DDK-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Isg15 (Myc-DDK-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Isg15 (mGFP-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Isg15 (GFP-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ISG15 (Myc-DDK tagged) - Human ISG15 ubiquitin-like modifier (ISG15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Isg15 (Myc-DDK-tagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Isg15 (Myc-DDK-tagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Isg15 (Myc-DDK-tagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Isg15 (mGFP-tagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Isg15 (GFP-tagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Lenti ORF particles, ISG15 (mGFP-tagged) - Human ISG15 ubiquitin-like modifier (ISG15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ISG15 (untagged)-Human ISG15 ubiquitin-like modifier (ISG15)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ISG15 (untagged)-Human interferon, alpha-inducible protein (clone IFI-15K), mRNA (cDNA clone MGC:3945 IMAGE:3545944), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene ISG15
Isg15 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Isg15 (untagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qPCR primer pairs and template standards against Mus musculus gene Isg15
| Application | Plasmid of exact quantity for transcript copy number calculation |
Rabbit Polyclonal Antibody against ISG15 (Center R87)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ISG15 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the Central region of human ISG15. |
Anti-ISG15 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
ISG15 / G1P2 (Calmodulin-tag) human recombinant protein, 0.5 mg
| Tag | Calmodulin-tag |
| Expression Host | E. coli |
ISG15 / G1P2 (Calmodulin-tag) human recombinant protein, 0.1 mg
| Tag | Calmodulin-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ISG15 CRISPRa kit - CRISPR gene activation of human ISG15 ubiquitin like modifier
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Isg15 CRISPRa kit - CRISPR gene activation of mouse ISG15 ubiquitin-like modifier
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ISG15
| Application | Plasmid of exact quantity for transcript copy number calculation |
Isg15 (untagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Isg15
ISG15 MS Standard C13 and N15-labeled recombinant protein (NP_005092)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Isg15 (untagged ORF) - Rat interferon, alpha-inducible protein (clone IFI-15K) (G1p2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ISG15 ubiquitin-like modifier (ISG15) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ISG15 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR322849 is the updated version of SR306412.
Isg15 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Isg15 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Isg15 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ISG15 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ISG15 |
ISG15 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ISG15 |
Active filters
Target Symbol
- ISG15