Germany
Japan
United Kingdom
China
KCNA2 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,020.00
In Stock
Lenti ORF particles, KCNA2 (Myc-DDK tagged) - Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
KCNA2 (GFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcna2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcna2 (GFP-tagged) - Mouse potassium voltage-gated channel shaker-related subfamily member 2 (Kcna2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, KCNA2 (mGFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Kcna2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508608 is the updated version of KN308608.
Lenti ORF clone of Kcna2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcna2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Kcna2 (GFP-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNA2 (Myc-DDK tagged) - Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNA2 (mGFP-tagged) - Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KCNA2 (Myc-DDK tagged) - Homo sapiens potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNA2 (GFP-tagged) - Homo sapiens potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcna2 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcna2 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcna2 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcna2 (mGFP-tagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcna2 (GFP-tagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Kcna2 (untagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Kcna2 (mGFP-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
KCNA2 (untagged)-Human potassium voltage-gated channel, shaker-related subfamily, member 2, mRNA (cDNA clone MGC:50217 IMAGE:5212949), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNA2 (untagged)-Human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Kcna2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
KCNA2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Kv1.2 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | IF |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142] |
Mouse Monoclonal Anti-Kv1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal Anti-KV1.2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2.Intracellular, C-terminus. |
Rabbit Polyclonal Kv1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
KCNA2 CRISPRa kit - CRISPR gene activation of human potassium voltage-gated channel subfamily A member 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Kcna2 CRISPRa kit - CRISPR gene activation of mouse potassium voltage-gated channel, shaker-related subfamily, member 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene KCNA2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene KCNA2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Kcna2
KCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004965)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Kcna2 (untagged ORF) - Rat potassium voltage-gated channel, shaker-related subfamily, member 2 (Kcna2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
KCNA2 (untagged) - Homo sapiens potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Kcna2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Kcna2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
KCNA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2 |
KCNA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA2 |
KCNA2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human KCNA2 (NP_001191198.1). |
| Modifications | Unmodified |
Transient overexpression of KCNA2 (NM_004974) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- KCNA2